KEGG   Meiothermus silvanus: Mesil_1653Help
Entry
Mesil_1653        CDS       T01246                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
msv  Meiothermus silvanus
Pathway
msv00620  Pyruvate metabolism
msv00680  Methane metabolism
msv00710  Carbon fixation in photosynthetic organisms
msv01100  Metabolic pathways
msv01120  Microbial metabolism in diverse environments
msv01200  Carbon metabolism
Module
msv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:msv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mesil_1653
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesil_1653
   00680 Methane metabolism
    Mesil_1653
Enzymes [BR:msv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mesil_1653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 MycE_N Ribosomal_S15
Motif
Other DBs
NCBI-ProteinID: ADH63538
UniProt: D7BFI5
LinkDB All DBs
Position
1655807..1658485
Genome map
AA seq 892 aa AA seqDB search
MVSDPLYDQLKREVDLLGRALGQAIKTLSGERLYHLEEEVRALTKHLRQNPGDAEAREKM
QRLIRGASLAEAEGLVRAFATYFHLVNLAEERQRVRVNRAREAESTPISPRSESFLGLVG
SLKAQGLSYEQVVRVLSELRLHLTFTAHPTETRRRTVRYHLGEIERLLEAREQGQPDADC
INAIEAHTMLLWGTLELRRTRMTVEDEVKGGLFYLPRTLWASIPRLVEGLERAVEAHYGA
RPDLSPPLVFRSWIGGDRDGNPNVTPDVTLWAQRYARELALQRFVEEIDGLIRALSLSED
RLPTPREIRLATEEASKKLPLPDRFAGEPYRRYLMIPRYKLRSLLGEQPGPGYASGGELV
AELRAIEAGLAQLGLKKVAQTLVKPARVRAEAYGLDLVSLDLREESRQHAEAVAELLRVG
GGSENYLELSPEEREALLTQELHSARPLAPVGYRPQTRALSVALGALHNWQARGAYVVSM
THHPSDLLEVFLLAREVGLYRPGRPLPFDVVPLFETLSDLEAAPRVVAELLENPIFQAHV
QGRGGMEVMIGYSDSNKDAGFLSANWALYRAQEQVAQVAQGRGVRVYFFHGRGTSTARGG
GSAGRAIASLPPGTVGTRMRITEQGEALADRYQHPELAYRNLEQMLYYMGLAAARDAYGQ
KDTVPQEWKDALEHAARESERVYRALLAEPRFFEFYEAFTPIREIGALNIASRPVYRSGR
VREITDLRAIPWVMSWTQVRLLLPGWYGIDAGLGQVPMELRREMYRGWPFFKSTLEAAAE
ALAKADLGIAREYLRLVSPELAEAFFPPIAQAFERSVKVLEETFQGSLLHNRPILARQTE
LRNPYVDPISHVQVELLARYRRTPPEHPERPGLERALMLSILGIAAGLRNAG
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggtttcggatcccctctacgaccagctcaagcgcgaagtagaccttttgggccgggct
ttgggccaggccattaaaaccctttccggtgagcgcctgtaccacctcgaggaggaggtt
cgggcccttaccaagcatctgcggcagaaccctggcgatgccgaagcccgtgaaaagatg
cagcgcctcattcgcggtgcttccctagcggaggccgaggggctggttcgggctttcgcg
acgtactttcacctagtaaacctggccgaggagcgccagcgggtgcgggtgaaccgtgcg
cgcgaggctgagtctacgccaatctcgccgcgctcggagtcgtttttgggtctggtaggt
tcgctcaaggcccaagggctcagctacgagcaggtagtgagggtactctccgaactgcgg
ctgcacctcacctttaccgcccaccccaccgagacccggcgccgcacggtacgctaccac
ttgggggagattgagcggctgttagaggcgcgggaacagggccagcctgacgcagactgc
ataaacgcaattgaagcccacaccatgctcctatggggtacgctcgagctgcgccgtacc
cgcatgaccgtggaggatgaggtgaaaggcggcctcttttacctgccccgcaccctctgg
gcctccatcccccgcctggtcgaagggctcgagcgggcagtagaggcccactatggcgca
cgccccgacctttcgcccccgctggtttttaggagttggatcggtggggatcgcgacggc
aaccctaatgtcacccccgacgttactttatgggcccagcggtatgcccgcgaattggcc
ttgcagcggtttgtggaggagatcgacgggctgatccgcgctctttccctaagcgaagat
cgcctgcctaccccgcgcgagattcgcctggccacggaggaagcttccaaaaaactcccc
ctacccgatcggttcgccggagaaccttaccgccgttacctgatgatcccccgctacaag
ctacgctcgctgttgggggaacagccggggccgggatatgcgagcgggggagagttagtg
gctgagttgcgcgctatcgaggctgggttagcccagttggggctgaagaaagttgcccag
accctggtaaaacctgcccgtgtacgggctgaagcctatgggctggacttggtttcgctc
gatctgcgggaggagtctcgccaacacgccgaggcggtagcggagctgctgcgggtaggg
gggggaagcgagaactacctcgagcttagcccagaagagcgcgaagcgttgctcacccag
gaactgcactccgcccgcccgttggctccggtcggctaccgcccccagacccgtgccctt
agcgtggctttgggcgcgttgcacaactggcaggcccgaggggcttatgtggtgagcatg
acccaccatcccagtgacctgctggaggttttcctcctagcccgcgaggtggggctttac
cgcccggggcgccctttgccgttcgacgtggtgccgctttttgaaactttgagcgacctc
gaggcagccccccgggtggtggcagagctgctggagaacccgatctttcaggcgcacgta
caagggcgcggggggatggaggtgatgatcggctactccgactccaataaagacgccggg
ttcctctcggccaactgggccttgtaccgggcgcaggagcaggtggcccaggtagcccag
gggcgcggggtgcgggtgtatttcttccacgggcgcggtacctccaccgcgcgcggtggg
ggcagcgcaggtcgggccatcgccagcttgccgcccggtacggtgggcacccgtatgcgc
atcaccgagcaaggagaagccttggccgaccgctaccagcaccctgagttagcctaccgc
aacctcgagcagatgctctactacatgggcttagccgctgcacgagatgcttacggacaa
aaagacaccgtgccccaggaatggaaggatgcgctcgagcacgccgcgcgcgagtccgag
cgggtgtaccgggccctgcttgccgagccgcgtttcttcgaattttatgaagcctttacc
cctatccgcgagatcggggcgctcaacattgcctcgaggcctgtctatcgctccgggcgg
gtgcgcgagatcaccgacttgcgcgcgattccctgggtaatgagctggacccaagtgcgg
ctgctgctgccgggttggtacgggatcgacgcaggcttgggacaagttcctatggagcta
cgccgggagatgtaccggggctggccatttttcaaaagcaccctcgaagccgccgctgaa
gcccttgccaaggccgacttgggtatcgcgcgggagtatctgcggctagtttcccccgag
ttggccgaggctttctttcctcccatcgctcaggctttcgagcgcagcgtgaaggtgctg
gaggaaacctttcaaggttcgttgctgcacaaccgccccatcctggcccgccagactgag
ttgcgcaacccctacgtcgaccccatcagccacgtccaggtcgagctgcttgcgcgttac
cgtcgaacccctcccgagcatcctgagcgacccggcctcgagcgggccttgatgctctcg
attttaggcattgctgcggggctgaggaatgcggggtga

DBGET integrated database retrieval system