KEGG   Methanosarcina siciliae T4/M: MSSIT_0125
Entry
MSSIT_0125        CDS       T03865                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
msw  Methanosarcina siciliae T4/M
Pathway
msw00300  Lysine biosynthesis
msw01100  Metabolic pathways
msw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSSIT_0125
Enzymes [BR:msw01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSSIT_0125
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N Mur_ligase NAD_binding_7 3HCDH_N AlaDh_PNT_C Shikimate_DH 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: AKB26844
UniProt: A0A0E3P0J7
LinkDB
Position
complement(153516..154295)
AA seq 259 aa
MALLTPEDLENINRQLQEADSTVRRVTGLDIKGVCKDFYGMTPCCEKVGIVPVTSGNGII
GNFSGSLHVITEYFGFDSFVTAMPDVSGYYEAVRNGARIILMADDNTFLAHNLKNGKIAN
NQPCTGRIYAEIASRYLKADSKDVLVVGLGKVGFPGAAHLVNKGFRVYGYDSDKALLEKT
VSDLGITLFEPENPRKFSIIFEATPCADTVPEFVISENCVISTPGIPCAISRELQEKYGV
ELVMEPLGIGTASMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccggaagacctggaaaacattaacagacagcttcaggaagctgat
tctactgtacggagagttacagggcttgacataaaaggagtctgcaaagacttctacggc
atgaccccatgctgtgaaaaagtaggcatcgtacctgtgacctcgggaaacgggatcata
ggaaatttctcgggatccctgcatgtaattaccgaatatttcggatttgacagctttgtt
acggctatgcctgatgttagcgggtactatgaagccgtaaggaacggagcccggattatc
cttatggcggacgataataccttccttgcccataacctcaaaaacgggaaaatagctaat
aaccagccctgcacaggcagaatttatgcggaaatagcctccagatatctgaaagccgat
tcaaaggacgtgcttgtcgttggactggggaaggtaggctttccgggagcagcgcatctc
gtaaataagggtttcagggtctatggatatgattctgacaaagctcttttagaaaaaact
gtttctgaccttggaattactctttttgaacccgaaaacccgagaaaattttccattatt
ttcgaggcaaccccctgtgcggatacggttcccgaattcgtaatttcggagaactgcgta
atttccacacccggaatcccctgcgcaatttccagggagcttcaagagaagtatggggtg
gaacttgtaatggaacctctcgggataggaacagcatccatgctgtattctgtcctgtaa

DBGET integrated database retrieval system