KEGG   Methanosarcina siciliae T4/M: MSSIT_1178Help
Entry
MSSIT_1178        CDS       T03865                                 

Definition
(GenBank) Tungsten-containing aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
msw  Methanosarcina siciliae T4/M
Pathway
msw00030  Pentose phosphate pathway
msw01100  Metabolic pathways
msw01120  Microbial metabolism in diverse environments
msw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSSIT_1178
Enzymes [BR:msw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     MSSIT_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AKB27897
UniProt: A0A0E3P5G8
LinkDB All DBs
Position
1439420..1441243
Genome map
AA seq 607 aa AA seqDB search
MPGGYNGKILDVNLDSGELKDLPLEEEMAKMYLGGKGLGLKLVYDEFRADMQPFDPDNLL
VFATGPATGAKLPTSGRYHIVCSKSPQTGTVGSGNSGGKWGPFLKFAGYDAVVVRGVSKE
PVYLSIVEGEAELVPAPELWGMTVHAVTDELAERTGNPKRTSVACIGPAGENLVPFSGIM
NDKYRTAGRTGLGAVMGSKKLKAIVVSGSKRVEPANPELLKERVAEAMKKIKENPVTAPD
GGLHTYGTAVLVNILNESGAYPTRNFQEAYFPDADEQSGETLVKKYLTGRGGCWGCPIVC
GRKADVPEGPYSVRDTEGPEYETIFAFGSDCGVKDLDALIKANHLCDELGLDTISMGGTI
ACAMELVEKGKIPPEKLHGFNLRFGDASSMIECIWRTAFRAGIGADLALGSKKLSEKYGA
PEFSMAVKGMELPAYDPRPIQGIGLNYATANRGGDHVYGYMISPEILGLPEKLDPYAVED
KPRWTIILQDLTSAINSSVVCLFSSFALGLPEYAGMLAAITGSDLDADKLLKLGERITNL
ERLMNNMYGLDRAEDVLPKRLTEEPVPSGPAKGQVSHVPEMINEYYALRGWVDGKPTKEK
LKELGIA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggggctataacggaaaaattcttgatgttaatcttgacagcggcgagctcaaa
gacctgccgcttgaagaagaaatggcaaagatgtacctgggaggcaaagggctaggcctg
aagctcgtatacgatgagttcagagcggatatgcagccctttgaccctgataacctgctt
gtgtttgcaaccgggccggctaccggagcaaagcttcccacgagcgggcgctaccatatt
gtctgcagcaaatccccgcagacagggaccgtagggagcggaaattccggcggaaaatgg
ggtcccttcctgaaatttgcaggatatgacgcagtcgttgtgcgcggagtctcaaaggag
cctgtctacctgagcattgtggaaggagaagccgagcttgtgccagctccggaactctgg
ggcatgacagtccatgcagtcacggacgaacttgccgaaaggacaggaaaccctaagaga
acctcggttgcctgtataggccctgcaggagaaaaccttgttcccttctccgggatcatg
aacgacaagtaccgaactgcagggaggaccgggcttggagctgtcatggggagtaagaag
ttgaaggcgatcgtggtttccgggagcaagagagttgaacccgcaaaccccgaactcctg
aaagagagagttgcggaagccatgaaaaagataaaggaaaatccggttacagctcccgac
ggagggcttcacacctacgggaccgcagttcttgtaaatatccttaatgaaagtggagcc
tacccgacacgaaactttcaggaagcctattttcctgacgctgacgaacagagcggagag
actcttgtcaaaaaatacctgacaggtcgcggaggctgctggggctgcccgattgtctgc
gggcggaaagccgatgtgcctgaggggccctacagcgtccgggacacggaaggtcctgag
tacgagaccatttttgcctttggttccgactgcggggtaaaggatctcgatgccctgata
aaagccaaccacctctgcgacgaactcgggcttgacaccatctccatgggtggaacgatt
gcctgtgccatggaacttgtggagaaaggaaaaatcccaccggaaaagctgcatggcttt
aacctgcgtttcggagatgcaagctcaatgattgaatgcatctggagaaccgccttccgt
gcagggatcggggctgaccttgcgctgggttcgaaaaagctttcggaaaaatacggggct
ccggagttctccatggctgtaaaaggcatggaactgcccgcctacgaccctcgcccgatc
cagggaataggcctgaactatgcaaccgcaaaccgcggcggggaccacgtctacggctac
atgatctcacccgaaatccttgggctgcccgaaaaacttgacccttatgcagtagaggac
aaacccagatggaccatcatcctgcaggacctgacttctgccattaactcctcggttgtc
tgcctctttagctcgtttgccctcggccttcccgagtatgcaggaatgctcgcagcgatt
acgggctctgatcttgacgccgataagctccttaaacttggagaaaggatcacaaacctc
gaacggctgatgaacaatatgtatgggcttgatagggctgaagacgtccttccaaagcgt
ctcaccgaagaaccggtcccttccgggcctgcaaaaggccaggtttcccacgtcccggaa
atgatcaacgagtattacgccctccggggctgggttgacggaaagcccacaaaagagaag
ctaaaggaactcgggattgcctga

DBGET integrated database retrieval system