KEGG   Marinobacter similis: AU14_05760Help
Entry
AU14_05760        CDS       T03594                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
msx  Marinobacter similis
Pathway
msx00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:msx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AU14_05760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:msx02000]
    AU14_05760
Enzymes [BR:msx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AU14_05760
Transporters [BR:msx02000]
 Other Transporters
  Pores ion channels [TC:1]
   AU14_05760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AHI28302
UniProt: W5YGH8
LinkDB All DBs
Position
1184166..1184798
Genome map
AA seq 210 aa AA seqDB search
MAITESSDCDLIFYTNPMSRGRIVRWMLEEVGADYRQVLLAYETNMKANDYLAINPMGKV
PALVHRGQVVTESAAICAYLADAFPDAGLAPDLTDRAAYYRWLFFAAGPLEAAVMDRVLK
AEVTSDLEKMVGYGTYDRTIDTLVQAVSDKPYIAGRQFTAADVYVGSHIMWGMEFGSIPK
RPEFEAYVEKLANRPALAAAKALDDNLIPQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaccgagtcttccgattgcgatctcattttctacaccaaccccatgtctcga
gggcgtattgtgcgctggatgctggaagaggtcggcgccgactatcgccaggttctgctc
gcctatgaaaccaacatgaaggccaatgactatctcgctatcaatcccatgggcaaagtg
ccggccctggtgcaccgtggccaggtggtaaccgaatctgccgctatttgtgcctatctt
gccgatgccttcccggatgcgggcctggcgcctgatctgactgatcgggcggcctattac
cggtggctgttctttgcagcgggcccgttggaggcggcggtgatggaccgcgtactcaag
gccgaggtcaccagcgacctggaaaaaatggtgggctacggcacctacgaccgcaccatt
gataccctggtgcaggcggtatcagataaaccctatatcgccggtcgccaattcaccgcg
gccgatgtctacgttggctcccacatcatgtggggtatggagttcggctcgattcccaaa
cgaccggaattcgaggcctatgtggaaaaactggcaaatcggcctgcactggccgcggca
aaggctttggacgacaatcttatcccccagtga

DBGET integrated database retrieval system