KEGG   Marinobacter similis: AU14_05790Help
Entry
AU14_05790        CDS       T03594                                 

Definition
(GenBank) hypothetical protein
  KO
K16953  dimethylpropiothetin dethiomethylase [EC:4.4.1.3]
Organism
msx  Marinobacter similis
Pathway
msx00920  Sulfur metabolism
msx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msx00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AU14_05790
Enzymes [BR:msx01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.3  dimethylpropiothetin dethiomethylase
     AU14_05790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMSP_lyase Cupin_7 Cupin_2
Motif
Other DBs
NCBI-ProteinID: AHI28305
UniProt: W5YGZ9
LinkDB All DBs
Position
1189188..1189865
Genome map
AA seq 225 aa AA seqDB search
MLDSHRRSTSMSRLSDHVDWQYVFREYWHLYRFGSAGGNRVIRSHLKDVRNRLNAELEIN
PEVTFDQPNSLPVCAWLGRAMDQGLNERTAPLVRSLARVIDQLTWRYGYERMRKGLARKY
AYAELMGPNGPVVSKKLILGLVLFAPRCTYPEHSHDGISESYICLSGSVSDSNYSVFTPG
SLLFNPPKRAHRMTTGDFEPTLLAYAWTGDEDKLAHQKMDFSIKK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgacagccaccggaggagcacctcgatgagcagactttccgatcacgtcgactgg
cagtatgtctttcgcgaatactggcacctctaccgcttcggatcagcaggcggtaaccgg
gttatccgctcgcacctgaaagacgtccgcaatcgcctgaatgcggagctggagatcaat
cctgaagttacctttgaccagcccaacagcctgccagtgtgtgcctggttgggacgggcc
atggaccagggcctcaatgagcgtacagcgccgctggtgcgctcgcttgcccgggtcatc
gatcagctcacctggaggtacgggtatgagcgcatgcgcaaggggctggcacgcaaatac
gcctatgcagagttgatggggccaaacggtcccgtggtcagcaaaaagctgattttgggc
cttgtcctttttgcaccccgctgcacctatcctgagcacagccacgacggtatcagcgaa
tcgtatatatgcctcagtggatccgtgtccgacagcaactacagcgtgttcacgccgggg
tcgttgctgtttaatccaccgaaacgggcacatcgaatgaccaccggtgatttcgagcca
acgttgctggcttacgcctggacaggcgatgaagacaagctggcccaccagaaaatggat
ttctcgatcaaaaagtaa

DBGET integrated database retrieval system