KEGG   Marinobacter similis: AU14_08400Help
Entry
AU14_08400        CDS       T03594                                 

Definition
(GenBank) glutathione S-transferase
Organism
msx  Marinobacter similis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 GST_N_4 GST_N_5 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AHI28620
UniProt: W5YHV6
LinkDB All DBs
Position
1758039..1758656
Genome map
AA seq 205 aa AA seqDB search
MKIFETKTAPNPRRVRMFMAEKGLLEKAEFVEIDLMKGENLTPEYVAKNPMKKVPVMELD
DGTCIAETMAICRYFEESYPDTPSLLGDTPLEKAQLEQWMRWIELFFFMPTGMCFQHTSG
YFKDRMNPIKEWGEECGQQVEKFLHFLNKQLEGKEYICLDRFTAADINAFTTIAFARVIN
IRIKPEQTNLQAWFERIKARPSAQV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctttgagaccaaaaccgccccgaatcctcgccgcgtgcgcatgtttatggcc
gaaaagggcttgctcgagaaggccgagtttgtcgagattgatctgatgaaaggcgagaac
ctgacaccggaatacgtcgcaaagaatccgatgaaaaaagttccggtgatggaactggac
gatggcacctgcattgccgaaaccatggccatctgccgctacttcgaggaaagctacccg
gacaccccaagtctactgggtgatactccgctcgagaaagcacagttggaacagtggatg
cggtggatcgagctgtttttcttcatgcccacgggcatgtgttttcagcacaccagcggc
tacttcaaggatcgcatgaatccgatcaaggagtggggcgaggagtgcggccagcaggtc
gagaagtttctgcacttcctgaacaagcagctagagggtaaagaatacatctgtctcgat
cgcttcactgcggccgatatcaatgccttcaccaccattgcctttgcccgggtgatcaat
atccgcatcaagcctgagcaaaccaatctgcaggcctggttcgagcgcatcaaggcgcgg
ccatcggcacaggtttaa

DBGET integrated database retrieval system