KEGG   Marinobacter similis: AU14_16795Help
Entry
AU14_16795        CDS       T03594                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
msx  Marinobacter similis
Pathway
msx00061  Fatty acid biosynthesis
msx00780  Biotin metabolism
msx01100  Metabolic pathways
msx01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:msx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AU14_16795
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AU14_16795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:msx01004]
    AU14_16795
Enzymes [BR:msx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AU14_16795
Lipid biosynthesis proteins [BR:msx01004]
 Fatty acid synthase
  Component type
   AU14_16795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: AHI29632
UniProt: W5YK73
LinkDB All DBs
Position
3523297..3523734
Genome map
AA seq 145 aa AA seqDB search
MMGIDEILEYLPHRYPFLLVDRVTEVEKGKSIKGYKNVSVNEPFFQGHFPNNPIMPGVLI
IEAMAQLSGILGFVTVGRKPADGVVQYLAGSSKARFKRPVLPGDQLCMESELISGKRGIY
KFECRALVDGDVVCVAEILTAEREV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgatgggaattgacgaaattctggaatacctgccgcatcgctatccgttcctgctagtg
gaccgggtgaccgaagtggagaaagggaaatcaattaagggttataagaacgtctcagtc
aacgagccattctttcagggccacttccccaataatccgatcatgccgggtgtgctgatc
atcgaggccatggcgcagctttctggcattctcggatttgtgaccgtgggacggaaaccc
gctgacggcgtggtacaatacctagctggatccagcaaggcacgcttcaagcggcctgtg
ttgccgggagaccaactctgcatggagtcagagctgatatccggcaagcgtggcatctac
aaattcgaatgtcgggcattggtcgacggtgacgtcgtgtgcgtggcagagattctgacc
gctgagagagaagtttga

DBGET integrated database retrieval system