KEGG   Methanosarcina siciliae HI350: MSSIH_0014Help
Entry
MSSIH_0014        CDS       T03864                                 

Definition
(GenBank) RNA ligase, family
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
msz  Methanosarcina siciliae HI350
Brite
KEGG Orthology (KO) [BR:msz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MSSIH_0014
Enzymes [BR:msz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MSSIH_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lig_C RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AKB30704
UniProt: A0A0E3P9M9
LinkDB All DBs
Position
complement(17624..18796)
Genome map
AA seq 390 aa AA seqDB search
MHKEENGEIDPDFINRLAGFLGFEEERVRHLFEKKYLARNWGKHEHMLRFDKEISHIEHG
TVLYEKGSSFEIIMGFPKIRRAMVLDPTLKKHFNGLSKLTVEEKMNGYNVRVAQVDGEIL
AITRSGYICPYTTERANAKLNLEFFDAFPELVLYGEMVGPDNPYVPKTIYDVESVEFFIF
DIREKNTGKPLPTAKRRETMEKYGFFQVRSFGEIPLETAPEEIANIIRELGKTEHEGVVI
KDPEMVLPSLKYTSSQSNCSDLRHAFKFYNEAGRDYMLSRIVREGFQTVEWDEDETEFKK
RCIQLGESILNPLRESIRSVKDGERLYEEVRIRVRDLKTATEFENYLKRLGVDTIFEAPQ
PAGNEYLVNIKKINKSTNDKTQAIWEGELW
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaagaggagaatggggaaatagaccctgactttataaaccggctggcgggtttc
ctgggctttgaggaagagagagtccggcacctttttgaaaagaagtaccttgcccggaac
tggggcaaacatgagcatatgctccgtttcgataaggaaatttcccatatagagcacggg
accgtactttatgaaaaaggcagctcttttgaaattatcatgggcttcccgaagattcgg
agagccatggtccttgaccccacgcttaaaaaacacttcaacggcctcagtaaactgact
gtagaagaaaaaatgaacgggtacaatgtccgggtagcgcaggtcgacggagagatcctt
gcaatcacccggagcggatatatctgcccctacacaacagaaagggcaaatgcaaaactt
aacctggagttctttgacgcttttccggaacttgttctctacggtgaaatggtaggccct
gacaacccatatgtcccgaagacaatctatgacgtcgagtccgtggagtttttcatcttc
gatatccgggagaaaaacacaggcaaacccctaccaacggcaaaaaggcgggagacgatg
gaaaaatatggctttttccaggtacgatcctttggggaaattcccctggaaacagccccc
gaagaaatcgcaaacatcatccgggaactggggaaaaccgagcatgaaggcgtggtcatc
aaagacccggaaatggtcctgccctctcttaagtacacctcctcccagagcaactgctcc
gacctcaggcacgccttcaagttttacaacgaagccggaagggattatatgctctcccgc
atagtccgggaaggttttcagactgtggaatgggacgaagacgaaaccgagttcaagaaa
cgctgtatacagcttggagaaagcatcctgaaccctctaagagaatcaataagaagtgta
aaggacggagaaagactctacgaagaggtcaggatcagggtaagggacctgaaaaccgcg
acagaatttgagaattacctcaaaagacttggggtagatacaatctttgaagccccacaa
ccggcaggaaacgagtatctggtaaacatcaagaaaatcaataaaagcaccaatgataaa
actcaggcgatctgggaaggagaactctggtga

DBGET integrated database retrieval system