KEGG   Methanosarcina siciliae HI350: MSSIH_0121
Entry
MSSIH_0121        CDS       T03864                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
msz  Methanosarcina siciliae HI350
Pathway
msz00300  Lysine biosynthesis
msz01100  Metabolic pathways
msz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSSIH_0121
Enzymes [BR:msz01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSSIH_0121
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N Mur_ligase NAD_binding_7 3HCDH_N AlaDh_PNT_C Shikimate_DH 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: AKB30811
UniProt: A0A0E3L9T1
LinkDB
Position
complement(150474..151253)
AA seq 259 aa
MALLTPEDLENINRQLQEADSTVRRVTGLDIKGVCKDFYGMTPCCEKVGIVPVTSGNGII
GNFSGSLHVITEYFGFDSFVTAMPDVSGYYEAVRNGARIILMADDNTFLAHNLKNGKIAN
NQPCTGRIYAEIASRYLKADSKDVLVVGLGKVGFPGAAHLVNKGFRVYGYDSDKALLEKT
VSDLGITLFEPENPRKFSIIFEATPCADTVPEFVISENCVISTPGIPCAISRELQEKYGV
ELVMEPLGIGTASMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccggaagacctggaaaacattaacagacagcttcaggaagctgat
tctactgtacggagagttacagggcttgacataaaaggagtctgcaaagacttctacggc
atgaccccatgctgtgaaaaagtaggcatcgtacctgtgacctcgggaaacgggatcata
ggaaatttctcgggatccctgcatgtaattaccgaatatttcggatttgacagctttgtt
acggctatgcctgatgttagcgggtactatgaagccgtaaggaacggagcccggattatc
cttatggcggacgataataccttccttgcccataacctcaaaaacgggaaaatagctaat
aaccagccctgcacaggcagaatttatgcggaaatagcctccagatatctgaaagccgat
tcaaaggacgtgcttgtcgttggactggggaaggtaggctttccgggagcagcgcatctc
gtaaataagggtttcagggtctatggatatgattctgacaaagctcttttagaaaaaact
gtttctgaccttggaattactctttttgaacccgaaaacccgagaaaattttccattatt
ttcgaggcaaccccctgtgcggatacggttcccgaattcgtaatttcggagaactgcgta
atttccacacccggaatcccctgcgcaatttccagggagcttcaagagaagtatggggtg
gaacttgtaatggaacctctcgggataggaacagcatccatgctgtattctgtcctgtaa

DBGET integrated database retrieval system