KEGG   Methanosarcina siciliae HI350: MSSIH_1128Help
Entry
MSSIH_1128        CDS       T03864                                 

Definition
(GenBank) Tungsten-containing aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
msz  Methanosarcina siciliae HI350
Pathway
msz00030  Pentose phosphate pathway
msz01100  Metabolic pathways
msz01120  Microbial metabolism in diverse environments
msz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSSIH_1128
Enzymes [BR:msz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     MSSIH_1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AKB31818
UniProt: A0A0E3PC28
LinkDB All DBs
Position
1383092..1384915
Genome map
AA seq 607 aa AA seqDB search
MPGGYNGKILDVNLDSGELKDLPLEEEMAKMYLGGKGLGLKLVYDEFRADMQPFDPDNLL
VFATGPATGAKLPTSGRYHIVCSKSPQTGTVGSGNSGGKWGPFLKFAGYDAVVVRGVSKE
PVYLSIVEGEAELVPAPELWGMTVHAVTDELAERTGNPKRTSVACIGPAGENLVPFSGIM
NDKYRTAGRTGLGAVMGSKKLKAIVVSGSKRVEPANPELLKERVAEAMKKIKENPVTAPD
GGLHTYGTAVLVNILNESGAYPTRNFQEAYFPDADEQSGETLVKKYLTGRGGCWGCPIVC
GRKADVPEGPYSVRDTEGPEYETIFAFGSDCGVKDLDALIKANHLCDELGLDTISMGGTI
ACAMELVEKGKIPPEKLHGFNLRFGDASSMIECIWRTAFRAGIGADLALGSKKLSEKYGA
PEFSMAVKGMELPAYDPRPIQGIGLNYATANRGGDHVYGYMISPEILGLPEKLDPYAVED
KPRWTIILQDLTSAINSSVVCLFSSFALGLPEYAGMLAAITGSDLDADKLLKLGERITNL
ERLMNNMYGLDRAEDVLPKRLTEEPVPSGPAKGQVSHVPEMINEYYALRGWVDGKPTKEK
LKELGIA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggggctataacggaaaaattcttgatgttaatcttgacagcggcgagctcaaa
gacctgccgcttgaagaagaaatggcaaagatgtacctgggaggtaaagggctaggcctg
aagctcgtatacgatgagttcagagcggatatgcagccctttgaccctgataacctgctt
gtgtttgcaaccgggccggctaccggagcaaagcttcccacgagcgggcgctaccatatt
gtctgcagcaaatccccgcagacagggaccgtagggagcggaaattctggcggaaaatgg
ggtcccttcctgaaatttgcaggatatgacgcagtcgttgtgcgcggagtctcaaaggag
cctgtctacctgagcattgtggaaggagaagccgagcttgtgccagctccggaactctgg
ggcatgacagtccatgcagtcacggacgaacttgccgaaaggacaggaaaccctaagaga
acctcggttgcctgtataggccctgcaggagaaaaccttgttcccttctccgggatcatg
aacgacaagtaccgaactgcagggaggaccgggcttggagctgtcatggggagtaagaag
ttgaaggcgatcgtggtttccgggagcaagagagttgaacccgcaaaccccgaactcctg
aaagagagagttgcggaagccatgaaaaagataaaggaaaatccggttacagctcccgac
ggagggcttcacacctacgggaccgcagttcttgtaaatatccttaatgaaagtggagcc
tacccgacacgaaactttcaggaagcctattttcctgacgctgacgaacagagcggagag
actcttgtcaaaaaatacctgacaggtcgcggaggctgctggggctgcccgattgtctgc
gggcggaaagccgatgtgcctgaggggccctacagcgtccgggacacggaaggtcctgag
tacgagaccatttttgcctttggttccgactgcggggtaaaggatctcgatgccctgata
aaagccaaccacctctgcgacgaactcgggcttgacaccatctccatgggtggaacgatt
gcctgtgccatggaacttgtggagaaaggaaaaatcccaccggaaaagctgcatggcttt
aacctgcgtttcggagatgcaagctcaatgattgaatgcatctggagaaccgccttccgt
gcagggatcggggctgaccttgcgctgggttcgaaaaagctttcggaaaaatacggggct
ccggagttctccatggctgtaaaaggcatggaactgcccgcctacgaccctcgcccgatc
cagggaataggcctgaactatgcaaccgcaaaccgcggcggggaccacgtctacggctac
atgatctcacccgaaatccttgggctgcccgaaaaacttgacccttatgcagtagaggac
aaacccagatggaccatcatcctgcaggacctgacttctgccattaactcctcggttgtc
tgcctctttagctcgtttgccctcggccttcccgagtatgcaggaatgctcgcagcgatt
acgggctctgatcttgacgccgataagctccttaaacttggagaaaggatcacaaacctc
gaacggctgatgaacaatatgtatgggcttgatagggctgaagacgtccttccaaagcgt
ctcaccgaagaaccggtcccttccgggcctgcaaaaggccaggtttcccacgtcccggaa
atgatcaacgagtattacgccctccggggctgggttgacggaaagcccacaaaagagaag
ctaaaggaactcgggattgcctga

DBGET integrated database retrieval system