KEGG   Methanosarcina siciliae HI350: MSSIH_2773Help
Entry
MSSIH_2773        CDS       T03864                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, archaeal
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
msz  Methanosarcina siciliae HI350
Pathway
msz00620  Pyruvate metabolism
msz00680  Methane metabolism
msz00720  Carbon fixation pathways in prokaryotes
msz01100  Metabolic pathways
msz01120  Microbial metabolism in diverse environments
msz01200  Carbon metabolism
Module
msz_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:msz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSSIH_2773
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSSIH_2773
   00680 Methane metabolism
    MSSIH_2773
Enzymes [BR:msz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MSSIH_2773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKB33463
UniProt: A0A0E3PGA7
LinkDB All DBs
Position
complement(3541742..3543322)
Genome map
AA seq 526 aa AA seqDB search
MSRKSTYPKVMCTQHPDSASRYISTQEEPGEAIEAAVVFGCDEYMPDYEGKATPYHQNVQ
IVSRLIEETDLVPGKDVFITPRAPSAVQENRFRQLMVMMSIAEANHGALEYSDVQAINEF
VHPMTGTVREILDAQQHMVDVSELAKKEFGFAMEVPRIIPLIEDAPALLHAKELAENTLL
AWKERFGTSPEKFRVFLGKSDSALSFGHVASTLSCKYAINGIFELNSELETETGIIFGAG
TLPFRGHLDLKNAENFFREYRGVGTITLQSALRYSHEKGDAESLVNLAKEKLPETPKIFS
AEEKEELVNLIGIFGTGYSRIIRELSSTINRLSDLLPQQRDRLMHRGSGGYSRSAPDISG
IVNLCRGDIGKELQASMPAENLHLPRAIKFTGALYSIGLPPEFIGTGTALKEAREKLGDE
ACERLLTKYFPSIVSDLSFASGYLDLNVASRFLSGACFKEVSKDIEVLHETLGLETHPEP
SYRILLEMMQPELLQAGTSGNCMDEEVSQLVCSTLTKMGKIRKALG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaaatcaacttatccgaaagttatgtgcactcagcacccggactctgcttca
aggtatatctccacacaggaagagccgggggaagccattgaagctgcggtggtattcggc
tgtgacgaatatatgccggactatgagggaaaggcaactccctatcatcagaatgtccag
atcgtatccagattaatagaagaaacagaccttgtgcccggaaaagatgtttttatcact
ccccgggctccgagtgcagtccaggaaaacaggttcaggcagcttatggttatgatgtcc
attgccgaagccaaccatggggctcttgaatactcggacgtccaggcaatcaatgagttc
gtgcatcccatgacaggaacggtcagggaaatccttgatgctcagcagcatatggtagac
gtaagcgagcttgcaaaaaaagaattcggatttgcaatggaggtcccgcgtataatccct
cttatcgaagatgctcccgccctcctgcacgcaaaagaacttgccgaaaacacgcttctt
gcctggaaagagcgcttcgggacatcccccgaaaaattcagggttttcctgggcaaatct
gactctgccctctctttcgggcatgtggcaagcaccctttcctgcaaatacgccataaac
ggaattttcgaactgaactccgaactcgaaaccgaaacaggcatcatcttcggagccgga
accctgcctttcagaggacaccttgacctgaaaaatgcggaaaacttcttcagggaatat
aggggtgtagggacaatcaccctgcagtctgctctcaggtacagccacgaaaaaggagat
gccgaatccctggtaaacctcgcaaaggaaaagctgcccgaaacccccaagatcttttcc
gcggaagaaaaagaagaactcgtaaatcttatcgggattttcgggacagggtacagccgc
atcatccgggaactgtcctctaccataaaccggctttccgacctcctcccccagcagcgg
gaccgcctgatgcatcgaggaagcggcggttattcacggagcgcccccgatatttcaggt
atagtaaacctctgccgcggcgacatcggaaaagagctgcaggcaagcatgcccgccgaa
aaccttcacctcccgcgggctatcaaatttaccggagccctctactccataggcctgcct
cccgaattcataggtaccgggactgcgcttaaagaagcccgggaaaaacttggagatgaa
gcctgtgaaaggctgcttacgaagtatttcccttccattgtcagtgacctgagtttcgct
tccggatacctggacctcaacgtagcttcccgcttcctttccggagcctgcttcaaggaa
gtcagtaaagatattgaggtcttgcatgagaccctcggccttgaaacccaccctgaacct
tcatatcgcatcctgcttgagatgatgcagcccgaactcctgcaggctgggacctcaggg
aactgtatggacgaggaggtttcacagctcgtatgctcgacccttaccaaaatgggaaaa
ataagaaaggctctgggttga

DBGET integrated database retrieval system