KEGG   Methanosarcina siciliae HI350: MSSIH_3750Help
Entry
MSSIH_3750        CDS       T03864                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
msz  Methanosarcina siciliae HI350
Pathway
msz00630  Glyoxylate and dicarboxylate metabolism
msz01100  Metabolic pathways
msz01120  Microbial metabolism in diverse environments
msz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSSIH_3750
Enzymes [BR:msz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSSIH_3750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB34440
UniProt: A0A0E3PJJ2
LinkDB All DBs
Position
4766589..4767875
Genome map
AA seq 428 aa AA seqDB search
MRRDYVDPGYSPIDTDLICEFHIEPAAGISFEEASTHMAGESSIDSWTEISTLSPELAAR
LKPHIFYLDANTQTVRVAYSEELFELGSVPQVLSAVAGNIFSMKIVGNLRLQDITFPKSM
LREFEGPNFGLPGVRDIVGVKDRPLVGTIVKPKVGLTSEMHAEVAYNAFAGGCDLVKDDE
NLTDQKFNGFEKRAELTLKVAEKAEAETGERKMYLCNITAPTCKEMVRRLHVLKDLGASY
AMIDIVPTGWTALQTLREAAADEGLALHAHRCMHSAFTRNPRHGVSMLLVAKLCRLIGLD
QLHIGTVVGKMHGDKNEVLSIRDECVLDTVPADPEQHVLAQDWGGLKPMFPVASGGLAPT
MIPDLYSIFGKEVIMQFGGGIHAHPMGTAAGAAACRQALEASLEGISLQDYAKDHKELEV
ALGKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagggactacgtagacccgggctacagcccgatagacacggatctgatctgtgaa
ttccatattgaaccggcagcaggaatcagttttgaggaagcttccacccatatggcaggg
gaaagctccatcgattcctggactgaaatttccactcttagccccgagcttgcagccagg
ttgaaacctcacatcttttacctggatgcaaatacccaaacggtccgggtggcttattcc
gaggagctcttcgaactcgggtccgtcccccaggtcctgagcgcggtggcgggcaacatt
ttcagcatgaagattgtgggcaacctgcgtctgcaggatatcaccttcccgaaatccatg
ctccgggagtttgagggaccgaacttcgggcttcccggggtccgggatatcgttggggtt
aaagacaggccccttgtagggacaatcgtcaagcctaaggtcggcctgacctcggaaatg
catgctgaagttgcatacaatgcttttgccgggggctgcgaccttgtaaaggacgacgag
aaccttactgaccagaagttcaacggatttgaaaagagggcggaactcaccctgaaagtt
gcggaaaaagcggaagcagaaaccggggagcggaaaatgtacctgtgcaatatcacggct
cctacctgcaaggaaatggtacggcgcctgcacgtgctaaaggatctcggggcaagttac
gccatgatcgacatcgtgcccacgggctggacagccctccagaccctccgggaagcagcc
gcagatgaaggcctggcgctccacgcccaccgttgcatgcattcggcattcacaaggaac
ccgaggcacggggtcagtatgctgctcgtggccaaactctgccggctgatcgggcttgac
cagctccatatcggtaccgttgtcgggaagatgcacggggataagaacgaagtcctttcg
atcagggacgaatgtgtgctcgataccgtacccgcagatccagaacagcatgtccttgcc
caggactggggagggctaaaaccgatgtttccggtagcatccggagggcttgcccctaca
atgattcctgacctttactctattttcggaaaagaagtcattatgcagttcggcggagga
atccatgctcacccgatgggcacggcagccggagccgctgcctgcaggcaggcccttgaa
gcaagccttgaaggcatcagcctgcaggactatgctaaggaccacaaagaacttgaagtt
gctctagggaaatggctgaagaaataa

DBGET integrated database retrieval system