KEGG   Moorella thermoacetica: Moth_1556Help
Entry
Moth_1556         CDS       T00308                                 

Definition
(RefSeq) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mta  Moorella thermoacetica
Pathway
mta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
mta01130  Biosynthesis of antibiotics
mta01230  Biosynthesis of amino acids
Module
mta_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Moth_1556
Enzymes [BR:mta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Moth_1556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 Cytidylate_kin AAA_17 dNK AAA_16 AAA AAA_28 CoaE AAA_22 KTI12 TsaE AAA_5 6PF2K cobW
Motif
Other DBs
NCBI-GeneID: 3832189
NCBI-ProteinID: YP_430408
UniProt: Q2RI74
LinkDB All DBs
Position
complement(1599500..1600021)
Genome map
AA seq 173 aa AA seqDB search
MPGNIVLIGFMGSGKTTVGRLLARDLGWSFLDTDTMVEERLGLPVKEIFAREGEEFFREV
EKEAVARVATARQAVIATGGGAVLCGVNVKLLREGNKVVWLQVRPETALKRAGLDDSRPL
LQGREPRDIAALLRRREPYYAFADIYIDTDGKEAAAVAREIKEALKAWLESLT
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgccggggaacatcgtcctgatcggttttatgggcagcggtaagacgaccgtcggccgg
ctcctggcccgggatctggggtggagcttcctggacaccgataccatggttgaggaacgc
ttgggcctgcccgtaaaagagatctttgcccgggaaggggaggagtttttccgggaagta
gaaaaagaagccgtcgcccgggtggcgaccgcccggcaggcagttattgccaccggcggg
ggggcggtcctttgcggggtcaacgtcaagttgctgcgggagggcaacaaggtcgtctgg
cttcaggtgcggccggagacggccctcaaacgggccgggctggacgacagccgtccccta
ctccaggggcgggaaccacgggacatcgccgccctcctccggcgccgggagccctattat
gccttcgctgatatctatatcgataccgacggtaaggaggcggccgccgtggcgcgggaa
ataaaggaggctttaaaggcgtggctggagagcttaacgtag

DBGET integrated database retrieval system