KEGG   Moorella thermoacetica: Moth_1852Help
Entry
Moth_1852         CDS       T00308                                 

Definition
(RefSeq) Alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
mta  Moorella thermoacetica
Pathway
mta00500  Starch and sucrose metabolism
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Moth_1852
Enzymes [BR:mta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Moth_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-GeneID: 3831713
NCBI-ProteinID: YP_430695
UniProt: Q2RHD7
LinkDB All DBs
Position
complement(1910654..1913218)
Genome map
AA seq 854 aa AA seqDB search
MMPSPHIFFVQPVLPEKLKPLRDLAASLYWPRYPETAALFRDLDPDLWEETGHNSELLLR
LLPAARLTAVARDPQYTGRLEQVWQQYRTYLGAPVNRGNLPGLESNQVIAYFSAEFGLSE
ALPIYAGGLGFLAGDHLKSASDLGLPLVGVGLLYREGYFRQRLDRRGQQREVYSRYDFYQ
LPLELERRADGSPLEVQVNFPDPDRQVRARVWRARVGRLNLYLLDSDCPGNLEADRLITD
RLYGGDLEKRIQQEILLGIGGVRALAALGINATIFHLNEGHSAFLGLERIRQLQARYGLD
LASARELATCSNIFTTHTPVPAGIDVFPPYLMDKYFTEYYQSLGLSRHEFLALGRQDPNN
QQEPFNMAVLALRLSAWANGVSQLHGQTARRMWQVIWPGVPVAEIPIGAITNGVHTTSWV
GEKMAALYDRYLGTAWREDPASPASWAGVAGIPARELWQVHEEQRRELLAFARRRLAAQL
REWGAGPREIAALEGVLDPGALTIGFARRFAAYKRPALLLRNPERLARILGDSRRPVQII
YAGKAHPRDEEGKELIRQITAFTREEAFRGRLIFLEDYGLQVARHLVQGVDLWLGNPRRP
LEASSTSGMKAVLNGALHASTLDGWWAEAWTPDTGWAIGSGAVYEDTGYQDAVEGEALYN
LLEKEIVPLFYERDAGGLPAAWVEMMKRSIRAYGPVFNTHRMVAEYSRQFYEPAARLYQR
LQAGNQERLKELAGWRSRVRDWWPAVRIEGVEDDREGDLIVGGSLKVRARVFLGFLQPED
VTVELYYGPVDAGGEIVTGEKETMIQYQDQGEGRYLYSGVIPCRRGGRQGYNLRVLPRHA
DQVHPYQSGLILWG
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgatgccttcaccccatatcttctttgtccagccggttttgccggaaaaacttaagccc
ctccgggatctggccgctagtctttactggcccaggtacccggaaacagcggcccttttc
cgggacctggaccccgacctctgggaggagaccggtcataactccgaactcttactgagg
ttactgccggcggccagattaacggcggtcgccagggaccctcaatataccggcaggctg
gaacaggtgtggcagcagtaccgcacctacctgggcgccccggtgaaccggggcaacctt
cccgggctggaaagcaatcaggttattgcctatttttctgccgagttcggcctgagcgag
gccctgcccatatatgccggggggctggggttcctcgccggagaccacctgaagtcggcc
agcgacctgggcctgcccttggtaggggtaggcctcctgtatcgcgagggttacttccgc
cagcgcctcgaccgccgggggcagcaacgggaggtttattcccgctatgatttctaccag
ctacccctggaactggagcgccgggccgacggctcgcccctggaggtgcaggtgaacttt
ccggacccggatcgccaggtccgggccagggtctggcgggctcgggtcggccgcctcaac
ctttacctcctggacagcgattgccccggcaacctggaggcggaccggttgattaccgac
cggctttacggcggcgacctggaaaaacggattcagcaggagatcctcctgggcatcggc
ggcgtgcgggccctggcggccctgggtatcaacgccactatctttcacctgaatgaaggc
cattcggccttcctgggcctggaaaggatccggcagttgcaggcgcggtatggactagat
ctggcgtcggcccgggaactggctacctgcagtaacatctttaccacccataccccggtg
ccggccggtatcgatgtctttcccccttatctaatggacaaatatttcaccgaatattac
cagtccctgggtctttcccgccacgaattcctggccctgggccggcaggaccccaataac
cagcaggaacccttcaatatggccgtactggccttacgcctgtcggcctgggccaacggc
gtcagccagctccacggccagacggcacgccggatgtggcaggtaatttggccgggagtg
ccggtagccgagattcccattggcgccattaccaacggtgtccataccacctcctgggtg
ggagaaaagatggccgccctctacgatcgctacctgggaacggcctggcgggaggacccg
gcctccccggccagctgggcgggggtggcaggcataccggcccgggaactctggcaggtt
cacgaagaacagcggcgggaactcctggcctttgcccggcggcgattggcggcccagctc
cgggagtggggggccgggcccagggagatagccgccctggaaggggttctcgatccaggg
gcattgaccatcggttttgcccgccgtttcgctgcctataaacggccggccctgctcctg
cgtaacccggaacgtttggccagaatcctgggggactcccggcggccggtccagatcatc
tatgccggcaaggcccaccccagggacgaagaggggaaggagctcatccggcagataacg
gcctttaccagggaggaggccttccgtggtcgtttgatcttcctggaggattatggcctg
caggtggcccgtcatctggtccagggtgtcgacttgtggctgggtaacccgcgacggccc
ctggaggccagcagtaccagcggcatgaaggccgttctgaacggcgccctccatgccagc
accctggatggctggtgggccgaagcctggaccccggataccggctgggccattggttcc
ggcgcggtttacgaggataccggctaccaggacgcggtagaaggggaggccctttataac
ttgctggagaaggagatagtccccctcttttacgagcgagacgccgggggcctgcccgcg
gcctgggtggagatgatgaaaaggtccatcagggcctacgggccggtgttcaatacccac
aggatggtggcggaatacagccggcagttttacgaacctgccgcccggctttaccagagg
ttgcaggccggcaaccaggagcggttaaaggagttggccggctggcggagccgggtccgg
gactggtggccggccgtgaggattgagggggtggaggacgacagggaaggggatctgatc
gtgggtggtagcctgaaggtccgggcccgggttttcttgggcttcctacagccggaggat
gtgacggtagaactctattacggcccggttgacgccggcggtgaaattgtgaccggagag
aaggagaccatgatccagtaccaggatcagggcgaaggaaggtacctgtatagcggcgtc
atcccctgccgtcgagggggacgccagggctacaacctgcgggtgttgccgcgtcatgca
gaccaggttcatccctaccagagcggcctgattctttggggttag

DBGET integrated database retrieval system