KEGG   Moorella thermoacetica: Moth_2082Help
Entry
Moth_2082         CDS       T00308                                 

Definition
(RefSeq) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mta  Moorella thermoacetica
Pathway
mta03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mta00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Moth_2082
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mta03400]
    Moth_2082
Enzymes [BR:mta01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Moth_2082
DNA repair and recombination proteins [BR:mta03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Moth_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 3831832
NCBI-ProteinID: YP_430918
UniProt: Q2RGR4
LinkDB All DBs
Position
complement(2173097..2174017)
Genome map
AA seq 306 aa AA seqDB search
MGQGRQYIRSQLLKRQLHLTNLDKVFWPEGLTKFDLIKYYVDMAPFLLPYLRDRPLVLKR
YPDGITGEAFYQKECPAYAPDWVTTLPVYHADSSKTINYVLCNNEETLIWLANQGCIEVH
AWLSRAGRLEYPDIAVMDLDPSAGATFKDVLDIALLVHQALKEFNLSGYPKTSGATGLHI
FIPLEPRWTFHQVTAAMGYLARLVAGVYPRKATTERSIPKRKDRVYLDYLQNVRGRSMAF
PYSLRPLPGAPVSTPLTWEEVKRGMFSPKDFNIHTARERLQAYGDLYRGFLAQPNDLEPL
LKLAGV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgggccagggccggcaatatatacggtcccaattgctgaagcgacagctccacttgacc
aacctggacaaggttttctggccggaaggtctgaccaagtttgatcttatcaagtattat
gtcgacatggctccctttctcttgccctacctccgggatcgccccctggtccttaagcgc
tacccggatggcataacaggggaggccttttaccagaaagagtgccctgcctatgccccg
gactgggttacgaccctgcctgtctatcatgctgatagcagcaagactattaattatgtt
ctctgtaataatgaagaaaccctgatctggctggccaatcaggggtgtatcgaggtccat
gcctggctctccagggccggccgcctggaataccccgatatcgccgtcatggatctggac
ccaagtgcgggggcaacttttaaagatgtcttggatatcgccctcctggtccaccaggct
ttaaaggagtttaacctcagcggctatcctaaaacctccggtgctactgggttgcatatc
tttatcccccttgaacctcgctggacctttcaccaggtgacagccgccatggggtacctg
gcgcggctggtcgccggggtttacccccgcaaggccaccaccgaacggtcgatcccgaag
cgtaaagatcgggtctacctggactacctgcagaacgtccgcggacggtccatggccttc
ccctacagcctgcgacccttacccggggcgccggtttcaacgcccctgacctgggaggag
gtaaagagggggatgttcagccccaaagacttcaacatccacaccgcccgggagcgcctg
caggcgtatggcgacctttatcggggttttctggcgcaaccaaacgatctggaaccgctg
cttaaactggccggggtttaa

DBGET integrated database retrieval system