KEGG   Mesoplasma tabanidae: MTABA_v1c02580Help
Entry
MTABA_v1c02580    CDS       T05273                                 

Gene name
ung
Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
mtab  Mesoplasma tabanidae
Pathway
mtab03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mtab00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    MTABA_v1c02580 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mtab03400]
    MTABA_v1c02580 (ung)
Enzymes [BR:mtab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     MTABA_v1c02580 (ung)
DNA repair and recombination proteins [BR:mtab03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     MTABA_v1c02580 (ung)
 Prokaryotic type
     MTABA_v1c02580 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ATZ21461
UniProt: A0A2K8P3X7
LinkDB All DBs
Position
279802..280452
Genome map
AA seq 216 aa AA seqDB search
MNSKWNNLLANNNLFKRILETMNSAYETKEIIYPSRKDCLRLFDLISPEEIKVVIIGQDP
YHNPKQANGIAFSASNEIKTPKSLINIFKELDNDLNVKHYQNNDLSGWVKQGVLLINTCW
TVIENNPGSHAKLGWQEIVSDILSNLNKSNPNLVYCLWGNYAKKVYENLEFKTNNVISSS
HPSPFSYLKGFKNTKPFSKINAILLNNNLEPIDWSK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaaatgaaataatttgttagcaaataataatctttttaaaagaattcttgaa
acaatgaatagtgcttatgaaactaaagaaattatttatccatcaagaaaagattgttta
aggttatttgatttaatatctccagaagaaattaaagttgttattattggtcaagatcca
tatcataatcctaaacaggcaaatggaattgcatttagtgcaagtaatgaaatcaaaact
cctaaaagtttaattaatatttttaaagagttagataatgatttgaatgttaaacattat
caaaataatgatttaagtggatgagttaaacaaggtgttttattaataaatacttgttga
acagttattgaaaataatcccggaagtcatgctaaattaggttgacaagaaatagttagt
gatattttaagcaatttaaataaaagcaatccaaatttggtttattgtctatgaggtaac
tatgcaaaaaaagtttatgaaaatttagagtttaaaacaaataatgtaattagctcttct
catccatcaccttttagttatttgaaagggtttaaaaacacaaagcctttttcaaaaata
aacgcaattttacttaataataatttagaaccaattgattggtctaaataa

DBGET integrated database retrieval system