KEGG   Meiothermus taiwanensis: Mtai_v1c07460Help
Entry
Mtai_v1c07460     CDS       T05633                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mtai  Meiothermus taiwanensis
Pathway
mtai00010  Glycolysis / Gluconeogenesis
mtai00020  Citrate cycle (TCA cycle)
mtai00620  Pyruvate metabolism
mtai01100  Metabolic pathways
mtai01110  Biosynthesis of secondary metabolites
mtai01120  Microbial metabolism in diverse environments
mtai01130  Biosynthesis of antibiotics
mtai01200  Carbon metabolism
Module
mtai_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtai_v1c07460 (pdhC)
   00020 Citrate cycle (TCA cycle)
    Mtai_v1c07460 (pdhC)
   00620 Pyruvate metabolism
    Mtai_v1c07460 (pdhC)
Enzymes [BR:mtai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mtai_v1c07460 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3
Motif
Other DBs
NCBI-ProteinID: AWR85990
LinkDB All DBs
Position
complement(749603..751006)
Genome map
AA seq 467 aa AA seqDB search
MPKEVVLPELAESVVEGEILRWLVNEGDFLKKDQPFVEVMTDKVTVELPSPYEGVLLQKL
VKEGQVVPVHAPIALIAEPGEVAAAVGDQKPAPAPSLQAQEERSIVEPGQVAEDDGASLS
LFKPDNKPEQVKNPFVKAAPLAVSGPSTATVQAHGRVIAVPAARKLARELGLDIAQIPGS
GPNGRVRVEDVKAYAEQTSRATPPAAAPSAPERAAPLLGLAPVQYKTPKGYEGLETRVPL
RGLRRAIAQQMMASHLYTVRTLSVDEVDMTELVALRNRLKPEAEAQGVRLSYLPFIFKAV
AVALKKFPALNSSLDEARQEVVLKHYVNIGMAVAAENGLIVPVVRDVERKSLLQIAREVG
DLAEKARSGKLAPEEVSGSTFSITNIGSIGALFSFPIINVPDAAILGVHSIQKRPVVGEN
DEIVVRQMMYLSLSFDHRLVDGAEAARFTKEVIRLLEKPERLFLEAL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagaagtggtgttgcccgagctggcagagtcggtggtggaaggtgaaattctc
cggtggctggtgaacgaaggcgattttttgaaaaaagaccagcccttcgtggaggtcatg
accgacaaggtcacggtggagctaccgagcccctacgaaggggtgctgctgcaaaagctg
gtcaaggaggggcaggtggtaccggtgcacgcccccatcgccctgattgccgagccgggc
gaggtggccgcagcggttggcgatcaaaagcccgccccggcccccagcctgcaagcccag
gaggagcgctccatcgtggagccgggccaggtagcagaagacgacggggccagcctctcg
ctgttcaagccggataacaagccagagcaggtcaaaaacccctttgtcaaagccgcgccg
ctggcggtatccgggccaagcaccgcaacggttcaggcccacggacgggtgatcgcggtg
ccggcggcccgcaagctggcccgcgagttggggctggacatcgcccagataccgggctcg
gggcccaacgggcgggtgcgggtggaggacgtgaaagcctacgccgagcaaacaagccgt
gccacaccgcccgctgccgcaccttcggcccccgagcgcgctgcgcccttgctgggcctg
gcgccggtgcagtacaagacccccaagggctacgaggggctcgagacccgcgtacccctg
cgcggcctgcggcgggccattgcccagcagatgatggcctcgcacctctacacggtgcgc
accctctcggtggacgaagtggacatgaccgagctggtggccctgcgcaaccggctcaag
cccgaggccgaggcccagggggtcaggctcagctacctgccctttatcttcaaggcggtg
gcggtggccctcaagaaattcccggccctgaacagctcgctggacgaggcaaggcaggag
gtggtgctcaagcactacgtcaatatcggcatggccgtggccgccgaaaacggcctgatt
gtgccggtggtgcgggacgtggagcgcaaaagcctgctgcagatcgcccgcgaggtgggc
gatctggccgagaaagcccgcagcggcaagctggccccggaggaggtgagcggctctact
ttcagcatcaccaacatcggctcgattggggcgctgttcagttttcctatcatcaacgtg
cccgacgccgccatcctgggcgtgcactccatccagaagcgcccggtggtgggcgagaac
gacgagattgtggtgcggcagatgatgtatctctcgctctccttcgaccaccggctggtg
gacggggccgaggcggcccgctttaccaaagaggtcatccggcttttggaaaaacccgag
cggctcttcctggaggcgctgtag

DBGET integrated database retrieval system