KEGG   Meiothermus taiwanensis: Mtai_v1c09230Help
Entry
Mtai_v1c09230     CDS       T05633                                 

Definition
(GenBank) hypothetical protein
Organism
mtai  Meiothermus taiwanensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C NADH_4Fe-4S Pyr_redox_2 AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AWR86167
LinkDB All DBs
Position
complement(940380..941348)
Genome map
AA seq 322 aa AA seqDB search
MRAVIAAPHKIDWIEAPPTQLQSGEVLLKPLAIGVCGSDLHVYEGQHPFVRYPVFPGHEV
AAQVVEVGSGVDPSWHGALVALEPSLTCGQCVPCRSGRYNICEQLRVMGFQAPGAMAEHF
VSPVQNLHRLPQGFDVELGAMIEPLAVAVHAVALTPVQGKQVAVLGAGTIGLLVAQVARA
YGAAGVVVVDVLEVRRRVAEGLGLVAKAPDTAKYEVIFECVGNEKAFEAAIQGARKGGTV
VVVGVYGQPATLSAGLIQDWELTLKGSLMYTFSDFQEAIRLLAEQRVQAHPLITHRFALK
QVQAAFAAALQRDQALKVLLLA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcggtgatcgctgcccctcacaagatcgactggatagaggcccccccaactcag
cttcaaagcggcgaggtgcttctcaagcctctggccattggggtgtgtggatcggatctg
cacgtatacgaaggccagcatccatttgtccgctacccggtcttccccggtcacgaggtg
gccgcccaggtggtggaggtgggttcgggggtagacccctcctggcacggggctttggta
gcgctcgagccctcccttacctgcggacagtgcgtcccgtgccgaagcggccgctacaac
atctgcgagcagctcagggtcatgggcttccaggccccaggggccatggccgaacacttt
gtgagccccgtccagaacctgcatcgcttaccccagggatttgatgtcgagttgggggcc
atgatcgaaccgctggcggtagccgttcacgcggtcgcccttacccccgtacagggcaag
caggtggcggttctgggtgcaggtaccatcgggctgctggtagcccaggtagcccgggcc
tacggtgcagccggggtagtggtggtggatgtgctcgaggttcgtcgccgggtggccgaa
gggcttgggctggtggccaaagcaccagacacggcaaagtacgaggtgatctttgagtgc
gtgggcaacgaaaaagccttcgaggcggccattcaaggagcccgtaaaggcggcacggtc
gtggtggtgggggtatacggccagccggccaccctatctgctggcctcatccaggactgg
gagctgaccctgaaaggaagcctgatgtacaccttttccgactttcaggaagccatccgg
ctgctggccgagcagagggtacaagcccacccccttatcacccaccgctttgccctgaag
caggttcaagcagcctttgcggctgcgctgcagcgagaccaggccctcaaggtgctgtta
ctggcctag

DBGET integrated database retrieval system