KEGG   Meiothermus taiwanensis: Mtai_v1c19480Help
Entry
Mtai_v1c19480     CDS       T05633                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mtai  Meiothermus taiwanensis
Pathway
mtai00620  Pyruvate metabolism
mtai00680  Methane metabolism
mtai00710  Carbon fixation in photosynthetic organisms
mtai01100  Metabolic pathways
mtai01120  Microbial metabolism in diverse environments
mtai01200  Carbon metabolism
Module
mtai_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mtai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mtai_v1c19480
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mtai_v1c19480
   00680 Methane metabolism
    Mtai_v1c19480
Enzymes [BR:mtai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mtai_v1c19480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AWR87182
LinkDB All DBs
Position
2012563..2015241
Genome map
AA seq 892 aa AA seqDB search
MNEERLFEQLKREVDVLGRALGKAIRTLSGPRIFELEEQVRELTKSLRQGYSPEARQQLL
EIVRGLSLSEAENVIRAFSTYFHLVNLAEERHRVRVNREREKNSTLGAPRGESFLALVGT
LKQQGLDYEQTVDLLSRLRLHLTFTAHPTETRRRTQRHHIHEIEKLLDSLYLDDLTTAAD
SSALDARVALLWGTSELRKSRPSVEDEVKGGLFYITSTLWKAVPRLVDGLERAVEAHYGQ
RPNLSPPLVFRSWIGGDRDGNPNVLPAVTSWAQTYARETALRRFVEDVDALIRDLSLSDE
RVTITHELRLALEDHAKRLALPERFQGEPYRQFGMGLRYKLRALLGEQPGPGYSSTGEFV
GDLGKAERSLEQLGLREIARACLKPIRLNAEAFGLDLVSLDLREESRALTEAAAELLKIG
GVHEQYAALPPQQREALLTQELATARPLAPVGYRPQSKSLQTALEALRNWKARGAHVVSM
THYPSDLLEVMLLAREVGLFRPGRALPFDVVPLFETLDDLQNAPEVVARLLDNPVFRAHV
QGRGGLEVMIGYSDSNKDAGFLAANWALYRAQEAITRVAQERGVTVYYFHGRGTSTARGG
GTAGRAIASLPPGTVGSRMRLTEQGEALADRYAHPELAYRNLEQMLYHMALASARDLYGQ
ARPLKPEWLEAMERAAERSTQVYRELLLRPGFFEFYEQLTPIREIGALNIASRPVYRSGR
VREIKDLRAIPWVMSWTQVRLLLPGWYGLAEGLQEIPLALRQEMFEQWPFFATTLDSAAI
ALAKADLGIAREYLRLVKPELAERFFPDIARSFEQTKAILEETFQNTLLFKHPVLARQTE
LRNPYVDPISLVQVELLERYRRTPPEAPERTGLERALMLSLLGIAAGLRNAG
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggaaaggctgttcgaacagctcaaacgcgaagtggacgtgctgggtcgggct
ttgggaaaggccatccgcacactttccgggccgcgcatcttcgaactggaagaacaggtg
cgcgagctgaccaaaagcctgcgacagggctattcccctgaggcccggcagcagctcctc
gagatcgtgcggggcctctcgctgtccgaggccgagaacgtgatccgggccttttcgacc
tactttcacctggtcaacctggccgaggagcgccaccgggtgcgggtcaatcgagagcgt
gagaaaaacagcaccctgggggccccccggggggaatcgtttctggcgttggtcggaaca
cttaagcagcaagggctggactacgagcaaaccgtcgatctgctctccaggctccggctg
cacctaacctttaccgcccaccccaccgagacccgccgccgcacccagcgccaccacatc
cacgagattgagaagctgctggacagcctctacctcgatgaccttacaacggctgcggat
agctcggccctcgatgcgcgggtggccctgctgtggggcacctccgagctgcgcaaatcc
cgcccgagcgtggaggacgaggtcaagggggggcttttttatatcacttctaccctttgg
aaggcggttccccggctggtggatgggctcgagcgggccgtggaggcccattatggtcag
cggcccaacctctcacccccgctggtctttcgtagctggattgggggcgaccgggacggc
aaccccaacgtgctgcccgcagtgacgagctgggcgcaaacctacgcccgcgaaaccgcc
ctgcgcaggtttgtggaggacgtggacgctctgatccgggacttatcccttagcgatgag
cgggttaccatcacccatgagctgcggctggccctggaggatcacgccaaacgcctggcg
ctgcctgagcggtttcagggcgagccttaccggcagtttggtatgggcctgcgctacaag
ctgcgggcgctgctgggcgaacagccaggccccggctatagcagcaccggggaatttgtg
ggggatcttggcaaagccgagcgcagcctggagcagcttggcttaagggagattgcccgg
gcctgcctcaagcccatccgtctcaacgccgaggctttcggcctggatctggtgagcctg
gatctgcgggaggagtcgcgcgcgctgaccgaggcggccgccgagctgctcaaaatcggc
ggtgtgcacgagcagtacgccgcgctcccccctcagcaaagggaagccttgctaacccag
gaactcgccacggcccggcccctggccccggtgggctaccggccccagagcaaaagcctg
caaaccgccctcgaggccctgcgcaactggaaagcccgcggggcccacgtggtctcgatg
acccattaccccagcgacctgctggaggtgatgttgctggcgcgggaggtggggctcttc
cgtcccggacgggccctgcccttcgatgtggtgccgctgttcgaaaccctggacgacctg
caaaacgcgccggaggtggtcgcgcggctgctggataatccggttttcagggcccatgtg
caggggcgggggggcctcgaggtgatgatcggctactccgactccaacaaggatgcgggc
tttttggcggccaactgggcgctgtaccgggcccaggaggccatcaccagggtagcccag
gaacgcggcgtgacggtctactatttccacggacggggcacctccaccgcccgcggcggg
ggcaccgcggggcgggccatcgccagcctgccgcccggcacggtgggcagccggatgcgc
ctgaccgaacagggcgaggccctggccgaccgctacgcccaccccgagctggcctaccgc
aacctcgagcagatgctctaccacatggccctggcctcggcccgcgacctctacgggcag
gcccggcccctcaaacccgagtggctcgaggccatggagcgggccgccgaacgctccacc
caggtctaccgggagctgctgctgcgcccgggcttcttcgagttctacgaacagctcacc
cccatccgcgagattggcgcgctcaacatcgccagccgcccggtctaccgctcggggcgg
gtgcgcgagatcaaggatctacgggccattccgtgggtaatgtcctggacgcaggttcgc
ttgctgctgcccggctggtatgggctggccgaaggattacaggaaattccgctggcgctg
cgccaggagatgtttgaacagtggcccttttttgccaccaccctggacagcgcagccatc
gctttagccaaagccgacctgggcatcgcccgcgagtacctgcggctggtcaagcccgag
ctggccgagcgcttcttccccgatatcgcccgctcgttcgagcaaaccaaggccattctg
gaagaaacctttcagaacaccctgctcttcaaacaccccgtgctggcccgccagaccgag
ctgcgcaacccctacgttgaccccatctcgctggtgcaggtcgagcttttggagcgctac
cgccgcaccccgcccgaggcccccgaacgcaccggcctcgagcgcgccctgatgctctcc
ctgctgggtattgcggccgggctgcgcaatgcgggctag

DBGET integrated database retrieval system