KEGG   Meiothermus taiwanensis: Mtai_v1c29370Help
Entry
Mtai_v1c29370     CDS       T05633                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
mtai  Meiothermus taiwanensis
Pathway
mtai00500  Starch and sucrose metabolism
mtai01100  Metabolic pathways
mtai01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mtai_v1c29370
Enzymes [BR:mtai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Mtai_v1c29370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AWR88156
UniProt: A0A2U9I659
LinkDB All DBs
Position
pMtWR-220:227615..230227
Genome map
AA seq 870 aa AA seqDB search
MKPIRTFNVVPSLPGPLEGLRRLAYNLRWSWNHDTIELFRRLDRELWEEVGHNPVLLLGR
IDQARLEAAAADAGFLAHLERALADLERYLSGELTWFTRAGGRRQGTLVAYFSAEFGLTE
SISVFAGGLGILAGDHLKSASDLGVPLVGVGLLYQQGYFRQYLNEAGWQQERYEDNDFHT
LPLTLERGPDGKPLAVEVAYPGRAVRAQVWRVQIGRVPLYLLDANLEVNRPEDRDLTDQL
YGGDPEMRLKQEILLGVGGYRALEALGLNPNPPVYHLNEGHAAFVALERIRRLMRSEDLS
FAEAREAASAGLVFTTHTPVPAGHDHFPPELLGRYLGEYARELGLSLEGLLALGRKNPAD
GRETFGMTTLALKLAAHSNGVSRLHGQVTRRTWRELWPGVPEEEIPIGHVTNGVHFQSWI
SLEMNQLYERYLGPSWREEPADRALWQGVYSIPDEELWRTHERRRERLVAFTRRRLQGQL
SRRGASEAELEAARGVLDPEALTIGFARRFTGYKRATLILSDPQRLARLLNDPAHPVQLI
FAGKAHPRDEEGKRLVQRVAELARQPAFARRLVFLEDYDMAVARALVQGADVWLNTPRRP
LEASGTSGMKAMANGALNLSTLDGWWDEAWQGADPDEPIGWAIGRGEDYPDPALQDRLEA
EALYGLLEQDVVPAFYERPGGLPRRWLARMKASIATLAPRYNTHRVVREYTQRCYLVGAE
RFRALAETGWGRARALAAWKERLQAAWPQVRVEAVKADLEGDLRVGQALDVWAWVSLGPL
TPEEVRVEVYLGRLDPGGELAQAGATAMRPVEAKGPGRHLFQAEAVPCQMSGLHGLTVRV
LPQHPDLPVPFLPGLIAWAGPESVAQQTSG
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcccatccgaaccttcaacgtggtcccgtcgctgccagggcccctcgagggcctc
aggcggctggcctataacctgcgctggagctggaaccatgacaccatcgagctttttcgc
cgcctggaccgcgagctgtgggaggaggtcggccacaacccggtgctgctgctggggcgc
atcgaccaggcccgcctggaggcggcggctgccgacgcgggcttcctggcccacctggag
cgcgcgttagccgacctggaacgctacctctccggcgagctgacctggttcactcgagcg
ggcggtcgccggcaggggacgctggtggcttacttctccgccgagttcggcctgaccgag
agcatttcggttttcgccggaggactggggatcctggccggggatcacctcaagtccgcg
agcgacctgggggtgccgctggtgggggtgggcctcctgtaccagcagggctatttccgc
cagtacctcaacgaggcgggctggcagcaggaacgctacgaggacaacgacttccacacc
ctgccgctgactctggagcggggccccgacggaaagcccctcgccgtcgaggtggcctac
cccggcagggcggtacgggcccaggtctggcgggtccagataggccgggtgcccctgtac
ctcctcgacgccaacctggaggtcaaccgccccgaggaccgcgacctcaccgaccagctt
tacggcggcgacccggagatgcgcctcaagcaggagatcctgctgggcgtcggcggctac
cgggcgctggaggccctgggcctcaaccccaaccccccggtctaccacctgaacgagggc
cacgcggccttcgtggcgctcgagcgcatccgccgcctgatgcgaagcgaggacctctcc
ttcgccgaggcccgcgaggccgcctcggcggggctggtcttcaccacccacaccccggtg
cccgccgggcacgaccacttcccgcccgagctcctggggcgctacctgggggagtatgcc
cgcgagctgggcctgagcctggagggtcttctggctctggggcgcaagaaccccgccgat
ggccgcgagaccttcggcatgaccaccctggccctgaagctggccgcacactctaacggg
gtgagccggctccacggccaggtcacccgcaggacgtggcgggagctgtggcccggcgtg
cccgaggaggagatccccatcggccacgtgaccaacggggtgcacttccaatcctggatc
tccctggagatgaaccagctctacgagcgctacctggggccctcctggcgcgaggagccc
gccgaccgagccctctggcagggggtgtactccatccccgacgaggaactctggcgcacc
cacgagcgccgccgcgagcggctggtggccttcacccgccgccgcctgcaagggcagctc
tcccggcggggggccagcgaggccgagctcgaggcggcccgaggcgtgctcgacccggag
gccctgaccatcggtttcgcccggcgcttcaccggctacaagcgggccacgctgatcctc
tccgacccccagcgccttgcacgcctcctcaacgacccggcccacccggtgcagctcatc
ttcgccggcaaggcccatccgcgtgacgaggagggcaagcggctcgtccagcgggtggcc
gagctggcccgccagcccgccttcgccaggcggctggtgttcctcgaggactacgacatg
gccgtggcccgggccctggtgcagggagccgacgtgtggctcaacaccccccgccgcccc
ctggaggcctcgggcacctcgggcatgaaggccatggccaacggggcgctcaacctgagc
accctggacggctggtgggacgaggcctggcagggcgccgaccccgacgagcccatcggc
tgggccatcgggcgcggcgaagactaccccgaccccgccctgcaggaccgcctcgaggcc
gaagccctctatggcctgctggaacaggacgtggtgcccgcgttctacgaacgcccgggc
ggcttgccccggcgctggctggctcgcatgaaggcctcgatcgccaccctggccccccgc
tacaacacccaccgcgtggtgcgcgagtacacccagcgctgctacctcgtgggggcggag
cgcttccgcgcgttggcggagacgggctggggccgggccagggccctggcggcctggaag
gagcgcctccaggcggcctggccccaggtgcgcgtcgaggcggtaaaggccgacctcgag
ggagacctgcgggtgggtcaggccctggacgtgtgggcctgggtgagcctgggcccgctc
acccctgaggaagtgcgggtcgaggtgtacctgggccgcttggacccgggcggcgagctg
gcgcaggccggagccaccgccatgcggccggtggaggcgaaggggcccggccgccacctc
ttccaggccgaagccgtgccctgccagatgagcgggctgcacggccttaccgtgcgcgtg
ctaccccagcaccccgatctgccggtccctttcctgcccggcctgatcgcctgggctggc
ccggagtcggtggcccagcagacgagcgggtag

DBGET integrated database retrieval system