KEGG   Mycobacterium tuberculosis CDC1551: MT0017Help
Entry
MT0017            CDS       T00053                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mtc01001]
    MT0017
Enzymes [BR:mtc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MT0017
Protein kinases [BR:mtc01001]
 Serine/threonine kinases: Other
  Bacterial family
   MT0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal Kdo
Motif
Other DBs
NCBI-ProteinID: AAK44239
UniProt: P9WI80
LinkDB All DBs
Structure
PDB: 

Position
complement(15590..17470)
Genome map
AA seq 626 aa AA seqDB search
MTTPSHLSDRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRADLARDPSFYLRFRREA
QNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
DACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAIADSGNSVTQTAAVIGTA
QYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARH
EGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVLTDAERTSLLSSA
AGNLSGPRTDPLPRQDLDDTDRDRSIGSVGRWVAVVAVLAVLTVVVTIAINTFGGITRDV
QVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHVIGTDPAANTSVSAGDEITVNV
STGPEQREIPDVSTLTYAEAVKKLTAAGFGRFKQANSPSTPELVGKVIGTNPPANQTSAI
TNVVIIIVGSGPATKDIPDVAGQTVDVAQKNLNVYGFTKFSQASVDSPRPAGEVTGTNPP
AGTTVPVDSVIELQVSKGNQFVMPDLSGMFWVDAEPRLRALGWTGMLDKGADVDAGGSQH
NRVVYQNPPAGTGVNRDGIITLRFGQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccttcccacctgtccgaccgctacgaacttggcgaaatccttggatttggg
ggcatgtccgaggtccacctggcccgcgacctccggttgcaccgcgacgttgcggtcaag
gtgctgcgcgctgatctagcccgcgatcccagtttttaccttcgcttccggcgtgaggcg
caaaacgccgcggcattgaaccaccctgcaatcgtcgcggtctacgacaccggtgaagcc
gaaacgcccgccgggccattgccctacatcgtcatggaatacgtcgacggcgttaccctg
cgcgacattgtccacaccgaagggccgatgacgcccaaacgcgccatcgaggtcatcgcc
gacgcctgccaagcgctgaacttcagtcatcagaacggaatcatccaccgtgacgtcaag
ccggcgaacatcatgatcagcgcgaccaatgcagtaaaggtgatggatttcggcatcgcc
cgcgccattgccgacagcggcaacagcgtgacccagaccgcagcagtgatcggcacggcg
cagtacctgtcacccgaacaggcccggggtgattccgtcgacgcccgatccgatgtctat
tccttgggctgtgttctttatgaagtcctcaccggggagccacctttcaccggcgactca
cccgtctcggttgcctaccaacatgtgcgcgaagacccgatcccaccttcggcgcggcac
gaaggcctctccgccgacctggacgccgtcgttctcaaggcgctggccaaaaatccggaa
aaccgctatcagacagcggcggagatgcgcgccgacctggtccgcgtgcacaacggtgag
ccgcccgaggcgcccaaagtgctcaccgatgccgagcggacctcgctgctgtcgtctgcg
gccggcaaccttagcggtccgcgcaccgatccgctaccacgccaggacttagacgacacc
gaccgtgaccgcagcatcggttcggtgggccgttgggttgcggtggtcgccgtgctcgct
gtgctgaccgtcgtggtaaccatcgccatcaacacgttcggcggcatcacccgcgacgtt
caagttcccgacgttcggggtcaatcctccgccgacgccatcgccacactgcaaaaccgg
ggcttcaaaatccgcaccttgcagaagccggactcgacaatcccaccggaccacgttatc
ggcaccgacccggccgccaacacgtcggtgagtgcaggcgacgagatcacagtcaacgtg
tccaccggacccgagcaacgcgaaatacccgacgtctccacgctgacatacgccgaagcg
gtcaagaaactgactgccgccggattcggccgcttcaagcaagcgaattcgccgtccacc
ccggaactggtgggcaaggtcatcgggaccaacccgccagccaaccagacgtcggccatc
accaatgtggtcatcatcatcgttggctctggtccggcgaccaaagacattcccgatgtc
gcgggccagaccgtcgacgtggcgcagaagaacctcaacgtctacggcttcaccaaattc
agtcaggcctcggtggacagcccccgtcccgccggcgaggtgaccggcaccaatccaccc
gcaggcaccacagttccggtcgattcagtcatcgaactacaggtgtccaagggcaaccaa
ttcgtcatgcccgacctatccggcatgttctgggtcgacgccgaaccacgattgcgcgcg
ctgggctggaccgggatgctcgacaaaggggccgacgtcgacgccggtggctcccaacac
aaccgggtcgtctatcaaaacccgccggcggggaccggcgtcaaccgggacggcatcatc
acgctgaggttcggccagtag

DBGET integrated database retrieval system