KEGG   Mycobacterium tuberculosis CDC1551: MT0127Help
Entry
MT0127            CDS       T00053                                 

Definition
(GenBank) coenzyme A synthetase, putative
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AAK44351
UniProt: Q7DAG1
LinkDB All DBs
Position
143989..145617
Genome map
AA seq 542 aa AA seqDB search
MLIVPNPHTEHMEGAFAMASDFGPRIADLVEVAATRLPEAPALVVTADRIAISHRDLARL
VDELAGQLTRSGLLPGDRVALRMGSNAEFVVALLAASRADLVVVPLDPALPITEQRVRSQ
AAGARVVLIDADGPHDRAEPTTRWWPLTVNVGGDSGPSGGTLSVHLDAATEPNPATSTPE
GLRPDDAMIMFTGGTTGLPKMVPWTHANIASSVRAIITGYRLSPRDATVAVMPLYHGHGL
IASLLATLASGGAVSLPARGRFSAHTFWDDIKAVGATWYTAVPTIHQILLERSATEPSGR
KPAALRFIRSCSAPLTAQAALALQTEFAAPVVCAFGMTEATHQVTTTQIEGIDQTETPVV
STGLVGRSTGAQIRIVGSDGLPLPAGAVGEIWLRGTTVVRGYLGDPTITAANFTDGWLRT
GDLGSLSAAGDLSIRGRIKELINRGGEKISPERVEGVLASHPNVMEAAVFGVPHQLYGEA
VAAVIVPRESAPPTREELVQFCRERLAAFEIPASFQEASGLPHTAKGSLDRRAVAERFGH
SV
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatcgtgccgaacccgcacaccgaacacatggaaggagcgttcgcgatggcatcc
gacttcggcccgcgcatcgccgatcttgtcgaggtggcggcgacccggctgcccgaggct
ccggcgctcgtcgtcaccgcggatcgcatcgcgatcagccaccgcgacctggcccgtctg
gttgatgagctggccggccagctgacgcggtccggcctgctgcccggtgaccgggtcgcg
ctgcgcatgggcagcaacgccgaattcgtcgtcgccttgctggcggcgtcgcgtgcggat
ctcgtcgtcgtgccgctggatccggcgctgcccatcaccgagcaacgcgtccgaagccag
gccgcgggagcccgggtggtgctgattgacgcagatgggccgcacgacagggcagaaccc
accacccggtggtggccgctcacggtgaacgtcggcggtgacagcggcccctcgggtggc
accttgtcggtccacctggacgccgccaccgagccgaaccccgcaacctcgacgcccgag
ggactgcgacccgatgacgccatgatcatgttcaccggcgggacgaccggcctgccgaag
atggtcccctggacgcacgcaaacatcgccagctcggtccgcgccatcatcaccgggtac
cggctgagcccgcgggacgccaccgttgcggtgatgccgctctaccatggccacgggctg
atcgcgtcgttgcttgccaccctggcgtccggcggcgcggtgtcgctgcccgcacgcggg
cgattctccgcgcacaccttctgggacgacatcaaagccgttggagccacctggtatacg
gcggttccgacgattcaccaaatcctgctggagcgatcggcaaccgaaccgtcggggcgc
aaacctgccgcactgcgtttcatccgcagctgcagcgcaccgctcactgcccaagccgcg
ctagcactgcaaaccgagttcgcggcaccggtcgtgtgtgccttcggcatgaccgaagcc
acccaccaggtaacgacaacgcagattgagggtatcgaccaaaccgaaactcccgtcgtg
tcaaccggtctggtcggccggtcgacgggagcgcaaatccggatcgtcgggtccgacggg
ctgccactgcccgcgggcgcggtcggggagatctggctgcgggggaccaccgtggtacgc
gggtatctgggtgacccgacgataaccgccgcgaatttcaccgacggttggttgcgtacc
ggtgatctcgggtccctgtcggcggccggtgacctgagcatccgcggccgcatcaaggaa
ctcatcaaccgaggtggtgaaaagatctcgcccgagcgcgtcgagggcgtgctggccagc
catccaaacgtcatggaggcagccgtattcggcgtcccgcaccagctctacggcgaggcg
gtcgcggcggtgattgtgcctcgtgagtccgccccgccgactcgcgaggagcttgtccag
ttctgccgggaacggttggcggccttcgagatcccggcctccttccaggaggccagcggg
ctgccgcacaccgcgaagggttcgctcgaccgccgcgctgtcgccgaacggttcggccat
tcggtgtag

DBGET integrated database retrieval system