KEGG   Mycobacterium tuberculosis CDC1551: MT0417Help
Entry
MT0417            CDS       T00053                                 

Definition
(GenBank) acyl-CoA synthase
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AAK44641
UniProt: P9WQ56
LinkDB All DBs
Position
485426..487183
Genome map
AA seq 585 aa AA seqDB search
MSVISTLRDRATTTPSDEAFVFMDYDTKTGDQIDRMTWSQLYSRVTAVSAYLISYGRHAD
RRRTAAISAPQGLDYVAGFLGALCAGWTPVPLPEPLGSLRDKRTGLAVLDCAADVVLTTS
QAETRVRATIATHGASVTTPVIALDTLDEPSGDNCDLDSQLSDWSSYLQYTSGSTANPRG
VVLSMRNVTENVDQIIRNYFRHEGGAPRLPSSVVSWLPLYHDMGLMVGLFIPLFVGCPVI
LTSPEAFIRKPARWMQLLAKHQAPFSAAPNFAFDLAVAKTSEEDMAGLDLGHVNTIINGA
EQVQPNTITKFLRRFRPYNLMPAAVKPSYGMAEAVVYLATTKAGSPPTSTEFDADSLARG
HAELSTFETERATRLIRYHSDDKEPLLRIVDPDSNIELGPGRIGEIWIHGKNVSTGYHNA
DDALNRDKFQASIREASAGTPRSPWLRTGDLGFIVGDEFYIVGRMKDLIIQDGVNHYPDD
IETTVKEFTGGRVAAFSVSDDGVEHLVIAAEVRTEHGPDKVTIMDFSTIKRLVVSALSKL
HGLHVTDFLLVPPGALPKTTSGKISRAACAKQYGANKLQRVATFP
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttatatccacgttgcgcgaccgtgcgaccacgactccaagcgacgaagccttt
gtgttcatggattacgacacaaaaaccggcgaccaaattgaccgaatgacgtggagtcaa
ttatattctcgcgtcaccgccgtgtctgcgtatctaataagttatggccggcatgctgac
cgacgaaggaccgcagcgatatcagctccgcaaggtctggactatgttgcaggatttcta
ggagcactgtgcgccggatggacgccggttccgttaccagaaccgctgggcagcctacgc
gataagcggactggactggctgtactcgactgtgccgccgacgtcgtgctgacgacgtcg
caagccgaaacgcgggtcagggccacgatagctacacatggggcgtctgtaactacgccg
gtcatagcgttggatacattggacgagccatccggagataactgtgatctcgattctcaa
ctatcagactggagttcgtatttgcagtatacttcgggttcaacggccaacccccgtggt
gtggttttatccatgcgtaacgttacggaaaatgtcgaccaaattatccgtaactatttt
cgccatgagggcggcgcgccgaggttgcccagctcggtcgtttcgtggttgccgctttac
catgacatgggtttaatggttggcctctttattccgttgtttgtcggatgtccggttatc
ctgacgagcccagaggcatttatccgtaagcctgccagatggatgcaactgcttgctaaa
caccaggcgccattttcggccgcgccgaacttcgcattcgatttggccgtcgctaaaact
tccgaagaggacatggcggggctggatttaggccacgtaaatacaataatcaacggcgcg
gagcaggtacagccaaatacaataaccaaattcctccgccggttccgtccctacaatttg
atgcccgcagcggtcaagccatcatacgggatggctgaagcggtggtttacctggcgacg
acgaaggcgggatcacctccaacgtcaaccgagttcgatgctgatagcttggctcgaggc
cacgcggagctaagtactttcgaaactgagcgtgcaacgcgtttaatacgctaccacagc
gacgacaaggaaccgttgcttcggattgtcgatccggactcgaatatcgagctcggaccg
ggacgtatcggcgagatttggattcacggtaagaatgtgtctaccggatatcacaatgca
gacgacgcgctcaatcgagataagttccaggccagcatccgggaggcctctgcgggaacg
ccaaggtcgccgtggcttcgcacgggagacttgggattcatagtaggagatgagttctac
atcgtcggccgtatgaaagatctcattatccaagacggtgtaaaccattatcccgatgat
atcgaaactacggtcaaggagtttaccggtggccgggtcgcggcattttcagtatccgac
gacggggtggagcatttggtcattgcggccgaggtaaggactgagcatgggcccgataaa
gtgactattatggatttctcgacgatcaaaaggctggtcgtatcggcgttgtcgaaatta
catggcctgcatgtaacagattttcttctggtaccgcccggggcgctaccgaagaccacc
agcggaaagattagccgggcggcatgcgcaaagcagtacggagcaaataagttgcaacga
gtagcaacgttcccatga

DBGET integrated database retrieval system