KEGG   Mycobacterium tuberculosis CDC1551: MT0842Help
Entry
MT0842            CDS       T00053                                 

Gene name
pstB-1
Definition
(GenBank) phosphate ABC transporter, ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MT0842 (pstB-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtc02000]
    MT0842 (pstB-1)
Enzymes [BR:mtc01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     MT0842 (pstB-1)
Transporters [BR:mtc02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    MT0842 (pstB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_30 Rad17 AAA_16 AAA_33 RsgA_GTPase AAA_15 AAA_18 AAA_13 AAA_19 AAA_29 AAA_28 AAA PRK AAA_23
Motif
Other DBs
NCBI-ProteinID: AAK45084
UniProt: P9WQL0
LinkDB All DBs
Position
912635..913411
Genome map
AA seq 258 aa AA seqDB search
MAKRLDLTDVNIYYGSFHAVADVSLAILPRSVTAFIGPSGCGKTTVLRTLNRMHEVIPGA
RVEGAVLLDDQDIYAPGIDPVGVRRAIGMVFQRPNPFPAMSIRNNVVAGLKLQGVRNRKV
LDDTAESSLRGANLWDEVKDRLDKPGGGLSGGQQQRLCIARAIAVQPDVLLMDEPCSSLD
PISTMAIEDLISELKQQYTIVIVTHNMQQAARVSDQTAFFNLEAVGKPGRLVEIASTEKI
FSNPNQKATEDYISGRFG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagcggttggacctcacggacgtcaacatctactacgggtcatttcatgcggtc
gctgatgtgtcgctggcgattctgccccgcagcgtcacggcgttcatcggtccctcgggc
tgcggcaagacgacggtgctgcgcaccttgaaccggatgcatgaggtcatccccggagct
cgagtcgagggtgccgtactgctcgatgatcaagatatctacgcccccggtatcgacccg
gtcggtgtccgccgggcaatcgggatggtgtttcagcggccgaatccattccccgccatg
tcgattcgcaacaatgtggttgccggcctgaagctgcagggtgtgcgcaatcgcaaggtg
ctcgacgatacggccgaatcctcgctgcgcggcgcaaacctgtgggacgaggtcaaggat
cgactggataaacccggcggcggattgtctggggggcagcagcagcggttgtgcatcgca
cgggcaatcgccgtgcaacccgacgtgttgctgatggacgagccctgctcctcgctggac
ccaatctccaccatggccatcgaagacctgatcagcgagctcaagcagcagtacaccatc
gtcatcgtcacccataacatgcagcaggctgcccgggtgagtgatcagacggcattcttc
aacctggaagcggtgggaaagccggggcggctggtagagatcgccagcaccgagaaaatc
ttctccaacccgaaccagaaggccaccgaggactacatctccgggcgcttcggctag

DBGET integrated database retrieval system