KEGG   Mycobacterium tuberculosis CDC1551: MT0965Help
Entry
MT0965            CDS       T00053                                 

Definition
(GenBank) conserved hypothetical protein/DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MT0965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mtc03400]
    MT0965
Enzymes [BR:mtc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MT0965
DNA repair and recombination proteins [BR:mtc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MT0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AAK45212
UniProt: P9WNV2
LinkDB All DBs
Structure
PDB: 

Position
1046149..1048428
Genome map
AA seq 759 aa AA seqDB search
MGSASEQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQ
PAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAE
PGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLY
TPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAP
YSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAPVADRLTRY
RRMRDASKTPEPIPTAKPVTGDGNTFVIQEHHARRPHYDFRLERDGVLVSWAVPKNLPDN
TSVNHLAIHTEDHPLEYATFEGAIPSGEYGAGKVIIWDSGTYDTEKFHDDPHTGEVIVNL
HGGRISGRYALIRTNGDRWLAHRLKNQKDQKVFEFDNLAPMLATHGTVAGLKASQWAFEG
KWDGYRLLVEADHGAVRLRSRSGRDVTAEYPQLRALAEDLADHHVVLDGEAVVLDSSGVP
SFSQMQNRGRDTRVEFWAFDLLYLDGRALLGTRYQDRRKLLETLANATSLTVPELLPGDG
AQAFACSRKHGWEGVIAKRRDSRYQPGRRCASWVKDKHWNTQEVVIGGWRAGEGGRSSGV
GSLLMGIPGPGGLQFAGRVGTGLSERELANLKEMLAPLHTDESPFDVPLPARDAKGITYV
KPALVAEVRYSEWTPEGRLRQSSWRGLRPDKKPSEVVRE
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggcgtcggagcaacgggtgacgctgaccaacgccgacaaggtgctctatccc
gccaccgggaccacaaagtccgatatcttcgactactacgccggtgttgccgaagtcatg
ctcggccacatcgcgggacggccggcgacgcgcaagcgctggcctaacggcgtcgaccaa
cccgcgttcttcgaaaagcagttggcgttgtcggcgccgccttggctgtcacgtgcaacg
gtggcgcaccggtccgggacgacgacctatccgatcatcgatagcgcaaccgggctggcc
tggatcgcccaacaggcggcgctggaggtgcacgtgccgcagtggcggtttgtcgccgag
cccggatcaggtgagttaaatccgggcccggcaacgcgtttggtgttcgacctggacccg
ggcgaaggcgtgatgatggcccagctggccgaggtggcgcgcgcggttcgtgatcttctc
gccgatatcgggttggtcaccttcccggtcaccagcggcagcaagggattgcatctgtac
acaccgctggatgagccggtgagcagcaggggagccacggtgttggccaagcgcgtcgcg
cagcgattggagcaggcgatgcccgcgttggtcacctcgaccatgaccaaaagcctgcgg
gccgggaaggtgtttgtggactggagccagaacagcggctcgaagaccaccatcgcgccg
tactcactacgtggccggacgcatccgaccgtcgcggcgccacgcacctgggcggagctc
gacgaccccgcactgcgtcagctctcctacgacgaggtgctgacccggattgcccgcgac
ggcgatctgctcgagcggctggatgccgacgctccggtagcggaccggttgacccgatac
cgccgcatgcgcgacgcatcgaaaactcccgagccgattcccacggcgaaacccgttacc
ggagacggcaatacgttcgtcatccaggagcatcacgcgcgtcggccgcactacgatttc
cggctggaacgcgacggcgtgctggtctcgtgggcggtaccgaaaaacctgcccgacaac
acatcggttaaccatctagcgatacacaccgaggaccacccgctggaatacgccacgttc
gagggcgcgattcccagcggggagtacggcgccggcaaggtgatcatctgggactccggc
acttacgacaccgagaagttccacgatgacccgcacacgggggaggtcatcgtgaatctg
cacggcggccggatctctgggcgttatgcgctgattcggaccaacggcgatcggtggctg
gcgcaccgcctaaagaatcagaaagaccagaaggtgttcgagttcgacaatctggcccca
atgcttgccacgcacggcacggtggccggtctaaaggccagccagtgggcgttcgaaggc
aagtgggacggctaccggttgctggttgaggctgaccacggcgccgtgcggctgcggtcc
cgcagcgggcgcgatgtcaccgccgagtatccgcaattgcgggcattggcggaggatctc
gccgatcaccacgtggtgctggacggcgaggccgtcgtacttgactcctctggtgtgccc
agcttcagccagatgcagaatcggggccgcgacacccgtgtcgagttctgggcgttcgac
ctgctctacctcgacggccgcgcgctgctaggcacccgctaccaagaccggcgtaagctg
ctcgaaaccctagctaacgcaaccagtctcaccgttcccgagctgctgcccggtgacggc
gcccaagcgtttgcgtgctcgcgcaagcacggctgggagggcgtgatcgccaagaggcgt
gactcgcgctatcagccgggccggcgctgcgcgtcgtgggtcaaggacaagcactggaac
acccaggaagtcgtcattggtggctggcgcgccggggaaggcgggcgcagcagtggcgtc
gggtcgctgctcatgggcatccccggtccaggtgggctgcagttcgccgggcgggtcggt
accggcctcagcgaacgcgaactggccaacctcaaggagatgctggcgccgctgcatacc
gacgagtcccccttcgacgtaccactgcccgcgcgtgacgccaagggcatcacatatgtc
aagccggcgctggttgcagaggtgcgctacagcgagtggactccggagggccggctgcgt
caatcaagctggcgtgggctgcggccggacaagaaacccagtgaggtggtgcgcgaatga

DBGET integrated database retrieval system