KEGG   Mycobacterium tuberculosis CDC1551: MT1088Help
Entry
MT1088            CDS       T00053                                 

Definition
(GenBank) medium-chain-fatty-acid--CoA ligase, putative
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Brite
Enzymes [BR:mtc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     MT1088
Lipid biosynthesis proteins [BR:mtc01004]
 Acyl-CoA synthetase
  Unknown
   MT1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF3659
Motif
Other DBs
NCBI-ProteinID: AAK45342
UniProt: L7N4U4
LinkDB All DBs
Position
1180730..1182361
Genome map
AA seq 543 aa AA seqDB search
MYGTMQDFPLTITAIMRHGCGVHGRRTVTTATGEGYRHSSYRDVGQRAGQLANALRRLGV
TGDQRVATFMWNNTEHLVTYFAVPSMGAVLHTLNIRLFPEQIAYVTNEAEDRVILVDLSL
ARLLAPVLPKLDTVHTVIAVGEGDTTPLREAGKTVLRFAELIDAESPDFGWPQIDENSAA
AMCYTSGTTGNPKGVVYSHRSSFLHTMAACTTNGIGVGSSDKVLPIVPMFHANGWGLPYA
ALMAGADLVLPDRHLDARSLIHMVETLKPTLAGAVPTIWNDVMHYLEKDPDHDMSSLRLV
ACGGSAVPESLMRTFEDKHDVQIRQLWGMTETSPLATMAWPPPGTPDDQHWAFRITQGQP
VCGVETRIVDDDGQVLPNDGNAVGEVEVRGPWIAGSYYGGRDESKFDSGWLRTGDVGRID
EQGFITLTDRAKDVIKSGGEWISSVELENCLIAHPDVLEAAVVGVPDERWQERPLAVVVV
REGATVSAGDLRAFLADKVVRWWLPERWAFVDEIPRTSVGKYDKKAIRSRYAEGAYQITE
VHT
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcacgatgcaggactttccgttgacgatcaccgcgatcatgcgccacggctgc
ggtgtccacgggcgacgcacggtcaccaccgcgacgggtgagggctatcggcacagtagc
tatcgcgatgtggggcaacgagctggccagctggcaaatgcgttgcgccgcctcggtgtt
accggggaccagcgggttgccacgttcatgtggaacaacaccgaacacttggtgacctac
ttcgcggtcccgtcgatgggcgcggtgctgcataccctcaacatccggctcttccccgag
cagatcgcctatgtcaccaacgaggccgaagaccgcgtcattctggtcgacttgtcattg
gccagactgctcgcgccggtgctgcccaaactcgacaccgtgcataccgtgatcgcggta
ggagagggcgacacgacgccgctgcgggaagctggcaagaccgtgctgcgcttcgccgaa
ttaattgacgccgaatcccccgacttcgggtggccgcagatcgatgagaactccgcggcc
gcaatgtgttacaccagcggtactaccggcaatcccaaaggcgttgtatacagccatcgt
tcgagctttctgcacacgatggcggcctgcaccacaaacggtatcggggtcgggtccagt
gacaaggtgctgccgatcgtgccgatgtttcatgccaacgggtgggggctaccgtatgcg
gccttgatggcgggtgcggacttggtgctacccgatcggcatctcgacgcccgctcgctg
atccacatggtggagacgctgaagccgacgttggccggcgcggtgccaaccatctggaac
gacgtcatgcattacctagagaaggaccccgatcacgacatgtcatcgctgcgtctggtc
gcctgcggcggatcggcggttccggaatcgctgatgcgcaccttcgaggacaagcacgat
gtccagattcggcagctgtggggcatgacggaaacatcgccgctggccaccatggcctgg
ccgccacctggcaccccggacgaccagcattgggcattccgcatcactcagggccaaccg
gtgtgcggggtggagacccggatcgtcgacgacgatggccaggtgctgcccaacgacggc
aacgccgttggcgaggtggaggttcgcgggccctggattgctggctcgtattacggggga
cgtgacgagtccaagttcgattccggctggttgcgcaccggtgacgtcggccgcatcgac
gagcaaggcttcatcaccctgaccgaccgcgccaaagacgtcatcaagtccggcggtgaa
tggatctcctcggttgagttggagaactgccttatcgcgcacccggacgtgctcgaggcc
gcggtcgtcggcgttcccgacgagcgctggcaggaacggccgctggcggttgtcgtagtt
cgggaaggggccaccgttagtgctggtgatctgcgagcattcctggcggacaaggtcgtt
cgctggtggttgccggagcggtgggcgtttgtcgacgagattccccgcaccagcgtgggc
aagtacgacaagaaggccatccgttctcgctacgccgaaggtgcctaccagatcaccgag
gtgcacacttga

DBGET integrated database retrieval system