KEGG   Mycobacterium tuberculosis CDC1551: MT1222Help
Entry
MT1222            CDS       T00053                                 

Definition
(GenBank) acyl-CoA synthase
  KO
K12423  fatty acid CoA ligase FadD21
Organism
mtc  Mycobacterium tuberculosis CDC1551
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtc01004]
    MT1222
Lipid biosynthesis proteins [BR:mtc01004]
 Acyl-CoA synthetase
  Unknown
   MT1222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AAK45479
UniProt: P9WQ48
LinkDB All DBs
Position
complement(1325263..1326999)
Genome map
AA seq 578 aa AA seqDB search
MSDSSVLSLLRERAGLQPDDAAFTYIDYEQDWAGITETLTWSEVFRRTRIVAHEVRRHCT
TGDRAVILAPQGLAYIAAFLGSMQAGAIAVPLSVPQIGSHDERVSAVLADASPSVILTTS
AVAEAVAEHIHRPNTNNVGPIIEIDSLDLTGNSPSFRVKDLPSAAYLQYTSGSTRAPAGV
MISHRNLQANFQQLMSNYFGDRNGVAPPDTTIVSWLPFYHDMGLVLGIIAPILGGYRSEL
TSPLAFLQRPARWLHSLANGSPSWSAAPNFAFELAVRKTTDADIEGLDLGNVLGITSGAE
RVHPNTLSRFCNRFAPYNFREDMIRPSYGLAEATLYVASRNSGDKPEVVYFEPDKLSTGS
ANRCEPKTGTPLLSYGMPTSPTVRIVDPDTCIECPAGTIGEIWVKGDNVAEGYWNKPDET
RHTFGAMLVHPSAGTPDGSWLRTGDLGFLSEDEMFIVGRMKDMLIVYGRNHYPEDIESTV
QEITGGRVAAISVPVDHTEKLVTVIELKLLGDSAGEAMDELDVIKNNVTAAISRSHGLNV
ADLVLVPPGSIPTTTSGKIRRAACVEQYRLQQFTRLDG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactcttctgtcttgtccttgctgcgcgagcgtgccggcctgcagcccgacgac
gccgcgttcacgtacatcgactacgaacaggattgggccggcatcaccgagacgctcacg
tggtcagaggtgtttcgacggacccgcatcgttgctcacgaagtcaggcggcattgcacg
accggagaccgagccgtgattctggctccgcagggcctggcctacatcgcggctttccta
ggttcgatgcaggccggagcgatagcggttccgttgtcagtcccgcagatcggctctcac
gacgaacgtgtcagcgcggtgcttgccgacgcgtcaccttcggtcatcctgacaacatct
gcggtcgcagaagcggttgccgagcacatccaccggccgaacacgaacaacgtagggccg
atcatcgaaatcgattcattggacttgaccgggaattcaccgagctttcgggtgaaggat
ctgccaagcgccgcgtacttgcagtacacctctggctccacccgcgctccggctggggtc
atgatctcgcatcggaaccttcaggcgaatttccaacagctgatgtcgaactacttcggc
gaccgcaacggtgtggcgccacctgacactaccatcgtgtcgtggctgccgttctaccac
gacatgggcttggtccttggcatcatcgcaccgatcctgggcggctaccgcagtgaactc
actagcccgctggcgttcctgcaacggccagcgcgttggctacattcgctggccaacgga
agtccttcgtggtcggccgcaccgaatttcgccttcgaattggccgtccgcaagacaaca
gatgccgacatagaaggcctcgacctcggcaacgtcctgggcatcaccagtggtgctgaa
cgagtccaccccaacacgctcagtagattctgcaaccggtttgcaccgtacaatttccgc
gaagacatgatacggccttcgtacggtctggcggaagcgactctttatgtggccagccgc
aattcgggtgacaagccagaagtcgtctacttcgaacctgacaagctgtccacgggcagt
gcgaatcgatgtgaacccaagaccggcacaccgctgctgagctatggcatgccgacatca
ccaacagtgcgaattgtggatcccgacacctgcattgagtgccccgcgggaacgatcggc
gagatctgggtgaagggcgacaacgtcgccgaaggctactggaacaaaccggacgagaca
cggcacacctttggcgcaatgctggtccacccctcggcaggtactcctgatggatcctgg
ttgcgaacgggagacctcggattcctctccgaggacgagatgttcatcgtgggccgtatg
aaggacatgctgatcgtatacgggcgcaatcactaccccgaggacatcgagtcgaccgtc
caggagatcactggtggtcgggtcgctgcgatttcagttccggtcgatcacacagagaag
ttagtcactgtcatcgagctcaagctcctcggcgattccgccggcgaagcgatggacgaa
ctcgatgtcatcaagaacaacgtcacagccgcgatatcacgctcgcacggtctcaacgtg
gcggacctcgtcttggtcccgcccgggtcgatccccaccacaaccagcggcaagatcaga
agggccgcctgtgtagagcaataccggctgcagcaattcacccggttggacggctga

DBGET integrated database retrieval system