KEGG   Mycobacterium tuberculosis CDC1551: MT1387Help
Entry
MT1387            CDS       T00053                                 

Definition
(GenBank) AMP-binding family protein
  KO
K01909  long-chain-fatty-acid--[acyl-carrier-protein] ligase [EC:6.2.1.20]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Pathway
mtc00071  Fatty acid degradation
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MT1387
Enzymes [BR:mtc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.20  long-chain-fatty-acid---[acyl-carrier-protein] ligase
     MT1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AAK45651
UniProt: P9WQ40
LinkDB All DBs
Position
1510664..1512061
Genome map
AA seq 465 aa AA seqDB search
MGLVGEPTVELVAAIQGAWLAGAAVSILPGPVRGANDQRWADATLTRFLGIGVRTVLSQG
SYLARLRSVDTAGVTIGDLSTAAHTNRSATPVASEGPAVLQGTAGSTGAPRTAILSPGAV
LSNLRGLNQRVGTDAATDVGCSWLPLYHDMGLAFVLSAALAGAPLWLAPTTAFTASPFRW
LSWLSDSGATMTAAPNFAYNLIGKYARRVSEVDLGALRVTLNGGEPVDCDGLTRFAEAMA
PFGFDAGAVLPSYGLAESTCAVTVPVPGIGLLADRVIDGSGAHKHAVLGNPIPGMEVRIS
CGDQAAGNASREIGEIEIRGASMMAGYLGQQPIDPDDWFATGDLGYLGAGGLVVCGRAKE
VISIAGRNIFPTEVELVAAQVRGVREGAVVALGTGDRSTRPGLVVAAEFRGPDEANARAE
LIQRVASECGIVPSDVVFVSPGSLPRTSSGKLRRLAVRRSLEMAD
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgggtctggtcggcgaaccgacggtcgagttggtcgccgcgatccagggtgcctggctt
gccggcgctgccgtgtcgatcctgcccgggccggtacgtggcgccaatgaccagcgatgg
gcggacgcgacgttgacccgtttcctcgggattggggtgcgcaccgtattgagccagggt
tcctaccttgcccgcctgcgatcggtcgatacggccggcgtaacgatcggagatctcagc
acggcggcgcacaccaatcgttcggccacaccggtggcgagtgaagggcccgcggtcctt
caaggtaccgcgggatcgacgggcgcgccccgtaccgccatcctttcgccgggcgcggtg
ctcagcaacttgcgtgggctcaatcagcgcgtgggcaccgatgctgcgaccgacgtcggt
tgctcatggttaccgctgtaccacgacatggggctcgctttcgtgctctctgctgcgctg
gccggtgcgccgctctggttggccccgacgacggcgttcacggcgtcgccgttccgttgg
ttgagttggctctcggacagtggtgccaccatgaccgcggcaccgaacttcgcctacaac
ctcatcggcaaatacgccaggcgggtatccgaggtcgacctgggtgccctgcgagtgacg
ctcaacggtggagagccggttgactgcgatgggctgacgcggttcgcggaggcgatggca
ccgttcggattcgatgccggcgccgtgttgccctcctacgggctcgccgagtcgacgtgc
gcggtgaccgtgccggtccccggaattgggttgcttgccgaccgtgtcatcgacggcagc
ggtgcgcataagcacgcggtcctgggtaaccccatccccggtatggaggtacggatctcg
tgcggtgatcaggcggcaggcaatgcgagccgtgaaattggcgaaatcgagattcgcggt
gcgtcgatgatggcgggttacctgggtcagcagccgatcgaccctgacgattggtttgcc
accggcgacctcggctatcttggcgctggcggcctggtggtgtgtggtcgcgcgaaggaa
gtcatctccatcgcgggacgcaacatctttccgacggaggtcgagctggtggcagcgcaa
gttcgcggagtgcgcgaaggcgccgtggtcgccttgggcaccggtgatcgctcgacccgc
cccggtctggtggtcgcggccgagttccgcggcccagacgaggcgaacgcccgcgccgaa
ctgatccaacgcgttgcgtccgagtgcggtatcgtcccgtccgacgtcgtcttcgtgtcg
cctggatcactgccccggacgtcgtctggaaaactgcgccgcttggcagtccggcgctcc
ctggagatggcggactga

DBGET integrated database retrieval system