KEGG   Mycobacterium tuberculosis CDC1551: MT2580Help
Entry
MT2580            CDS       T00053                                 

Definition
(GenBank) substrate--CoA ligase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
mtc  Mycobacterium tuberculosis CDC1551
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtc01004]
    MT2580
Enzymes [BR:mtc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     MT2580
Lipid biosynthesis proteins [BR:mtc01004]
 Acyl-CoA synthetase
  Unknown
   MT2580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AAK46884
UniProt: O06168
LinkDB All DBs
Position
complement(2815441..2817084)
Genome map
AA seq 547 aa AA seqDB search
MAAAEVVDPNRLSYDRGPSAPSLLESTIGANLAATAARYGHREALVDMVARRRFNYSELL
TDVHRLATGLVRAGIGPGDRVGIWAPNRWEWVLVQYATAEIGAILVTINPAYRVREVEYA
LRQSGVAMVIAVASFKDADYAAMLAEVGPRCPDLADVILLESDRWDALAGAEPDLPALQQ
TAARLDGSDPVNIQYTSGTTAYPKGVTLSHRNILNNGYLVGELLGYTAQDRICIPVPFYH
CFGMVMGNLAATSHGAAMVIPAPGFDPAATLRAVQDERCTSLYGVPTMFIAELGLPDFTD
YELGSLRTGIMAGAACPVEVMRKVISRMHMPGVSICYGMTETSPVSTQTRADDSVDRRVG
TVGRVGPHLEIKVVDPATGETVPRGVVGEFCTRGYSVMAGYWNDPQKTAEVIDADGWMHT
GDLAEMDPSGYVRIAGRIKDLVVRGGENISPREIEELLHTHPDIVDGHVIGVPDAKYGEE
LMAVVKLRNDAPELTIERLREYCMGRIARFKIPRYLWIVDEFPMTVTGKVRKVEMRQQAL
EYLRGQQ
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtggcagccgcggaagtcgtagaccccaatcggctttcctatgatcgcggtccgagtgcg
ccatcattgctcgagtcgaccatcggcgccaacctcgcagcgaccgctgccaggtacgga
catcgggaagcactcgtggacatggtggcccggcgacggttcaattacagcgaactgctg
actgacgtgcaccggctggcgacggggctggtgcgggcggggatcggcccgggcgatcgg
gtcggcatctgggcaccgaaccggtgggagtgggtgctcgtccagtacgcgaccgctgag
atcggcgcgatcctagtgaccataaaccccgcctatcgggtccgcgaagtggagtatgcg
cttaggcagtccggtgtcgcgatggtgattgccgtagcgagtttcaaggatgcggactat
gccgcgatgctggccgaggttgggccgcgatgccccgatctggccgacgtgattttgctg
gaaagcgatcgctgggacgcgctggcgggtgccgagcccgatctgcctgcgctgcagcag
accgcggcgaggctagacggcagtgatccggtaaacatccaatacacctccggcacaacg
gcatacccgaagggtgtcacgctaagccaccgcaatatcctcaacaacggctacctggtg
ggcgagctgctcgggtacaccgcacaagatcggatttgcatcccggtgcccttctaccac
tgcttcggcatggtaatgggaaatctggcggccaccagtcacggggcggccatggtgatc
ccggcgccgggctttgaccctgcggccacgctgcgcgcggtgcaggacgagcgatgcacc
agcttgtacggcgtgccgacgatgttcatcgccgagctgggcctgccggacttcaccgac
tacgaactgggcagtctgcgcaccgggattatggccggcgccgcgtgcccggtcgaggtg
atgcgcaaggtgatctcacgcatgcatatgcccggggtctcgatctgctatggaatgacc
gaaacgtcaccggtttccacgcagacgcgcgccgacgactcggtggatcgacgggtcggc
acggtcggtcgggtgggtccacaccttgagatcaaggtggtggatccggccacgggcgag
acggtcccgcgcggggtggtcggcgagttctgcacgcgaggctattcggtgatggccggg
tactggaatgacccgcagaagactgcggaggtgatcgacgccgacggctggatgcacacc
ggagatctggctgagatggacccgtccgggtacgtgcggatcgccggccggatcaaagac
ctcgtcgtccggggcggcgagaacatctcgccgcgggagatcgaggaactcctccacacg
catcccgatattgtcgacggtcacgtcatcggggtgcccgacgccaaatacggcgaagag
ctcatggcggtggtcaagctgagaaacgacgcgccggaactgaccatcgagcggctgcgc
gagtactgcatgggccgcatcgcgcgattcaagatcccgcggtacctgtggatcgtcgac
gagttcccgatgaccgtcaccggcaaagtacgcaaagtggagatgcgacaacaggcgctc
gaatacctccgcggccaacagtga

DBGET integrated database retrieval system