KEGG   Mycobacterium tuberculosis CDC1551: MT3296Help
Entry
MT3296            CDS       T00053                                 

Definition
(GenBank) helicase, UvrD/Rep family
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDDEXK_1 UvrD-helicase UvrD_C AAA_19 AAA_30 DUF2075 AAA_29
Motif
Other DBs
NCBI-ProteinID: AAK47639
UniProt: L7N4V4
LinkDB All DBs
Position
complement(3571938..3575105)
Genome map
AA seq 1055 aa AA seqDB search
MSHIWGVEAGAALAPGLRGPVLVLGGPGTGKSTLLVEAAVAHIGAGTDPESVLLLTGSGR
MGMRARSALTTALLRSRTNGPCRAAIREPVVRTVHSYAYAVLRKAAQRAGDALPRLLTSA
EQDAIIRELLAGDAEDGPAATTTWPAHLRPALTTAGFATELRNLLARCAERGLDPLELQQ
LGRRRGRPEWIAAGQFAQRYEQVMLLRGAVGLAAPQATAPALSAAELVGAALEAFAVDPE
LLAAERARVRTLLVDDAQQLDPQAARLVRMLAAGTELALIAGDPNQAVFGFRGGEPTGLL
ADDPPPAGGAPIPSVTLTVSHRCAPAVARAVTGIARRLPGRSVGRRIEGTGTEVGSVTVR
LAGSAHAEAAMIADALRRAHLIDGVPWSQMAVIVRSVPRAVRLPRALAAAGVPVAPPAVG
GPLSAEPAVRALLTVLEATADGLDGDQALLLLTGPIGGVDPVSLRQLRRTLQRARPGQTS
RKFGDLLVEVLGGDAPPSGPGSRALRRVRAVLTAAARCHRSGSLGGQDPRHTLWAAWQRS
GLQRRWLAASEHGGAAAVQATRDLETVTALFDITDHYVSRTSGASLRGLVEHVTALQLPV
VRPEPAAPTEQVMVLSAHAALGHEWDLVVIAGLQDGLWPNTVPRGGVLGTQRLLDELDGV
TKDASMRAPLLAEERRLLVTAMGRARRRLLVTAVDSDAGGGGHEAVLPSAFFFEIAQWAD
GDGEPVAMQPVSAPRVLSAAAVVGRLRVVVCAPACAVDDADRDCAATQLARLAKAGVPGA
DPSEWHGLAPVSTSDPLCDSDDLVTLTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGS
VLHALFAEPGRSESQLLAELDRVWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSEL
TEVGVEVDIDGALEDGSGQARKIRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQH
AQLAMYQLAVAEGLVRAGDEPGGARLVYVGKSGAAGVAERKQDPLTPAARDEWRNLVRQL
AAATAGPQFIARRNDGCTHCPLRPGCPAHVRGSAP
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatatctggggtgtcgaggcgggtgcggccctcgcgccgggtttgcgcggtccg
gtgcttgtgctgggcggcccgggcaccggtaagagcacactgttggttgaggccgcggtc
gctcacatcggcgccggcaccgacccggagtcggttctgctgctgaccggttccggccga
atgggcatgcgggcccgcagtgcgctgacgacggcgctgctgcggtcgcgcaccaacggc
ccttgccgggcggcgatccgcgaaccggtggtacgcaccgtgcacagctacgcctatgcg
gtcttgcgcaaggccgcacagcgcgccggtgacgccttgccgcggctgcttaccagcgcc
gagcaggacgccatcattcgggaactgctggccggggacgccgaagacggaccggccgcc
accaccacctggcctgcgcatctgcggcccgcgctgactaccgccggcttcgccaccgag
ctgcgaaacctgttggcacgttgcgccgaacgcggcctggacccgctggagttgcagcaa
ctgggccgtcgccgcggccgtccggaatggatcgccgccggtcaattcgcccagcggtac
gagcaggtgatgttgttgcggggtgcggtggggctggcggcgccgcaggccacggcgccg
gcgctgagtgccgccgaactggtgggggcagctttggaggccttcgcggtcgatcctgag
ttactggccgccgaacgcgcccgggtccggacccttttggtcgacgacgcccaacaactt
gatccgcaggcggcacgcctggtccggatgctggcggcgggcaccgagctggccctgatc
gccggtgatccgaaccaagcggtgttcgggttccgcggcggcgagcccaccggcctgctg
gccgacgatccgccgccagcaggtggtgcccccattccgtcggtgacgttgacggtctct
catcggtgtgcacccgccgtggcgcgggccgtcaccggcatcgcacgacggctaccgggt
cgaagcgtcggtcggcgaatcgagggcaccgggaccgaggtcggatcggtgacggtgcgc
ctggccggttcggcgcacgctgaggcagcgatgattgccgacgcgctgcgacgcgcgcac
ctgatcgatggggtgccttggtcgcagatggcggtgatcgtcaggtcggtgccgcgcgct
gtgcggttgccgcgcgctctggccgccgccggggtgccggtggccccacctgcagttggc
gggccgttgtccgcggagccggcggtacgggcgctgctcacggtgctcgaggcgacggct
gacgggctcgacggcgaccaggcgctgctcctgctcaccgggccgattggtggtgtggac
ccggtatcacttcgccagctgcgccggactctgcaacgcgcacgtcccggccagacttcg
aggaagttcggcgacctgctggtggaagtgctcggcggcgacgcgccgccatcggggcca
gggtcgcgggcactgcggcgcgtgcgtgccgtgctgaccgcggccgcgcgctgccaccgc
tcaggaagtctgggtggccaggatccgcgccacacgctatgggctgcctggcaacggtcg
ggtctgcaacgccgctggctggcggccagcgagcatggtggtgcggcggctgtccaggcc
acccgggacctggaaacggtgaccgccttgttcgacatcaccgaccattacgtgtcccgc
acctcgggtgcgtccctgcgcggactcgtcgagcacgtcaccgcgctgcagctgccggtt
gtgcgacccgaaccggcagccccgacagagcaggtcatggtccttagcgcacatgccgcg
ctgggacacgaatgggatctggtagttatcgccggcctacaggacggcttgtggcccaac
acggttccacgtggcggtgtgcttggcacccagcggctgctggacgaactcgacggtgtc
acgaaggatgcctcgatgcgcgcgccgttgctggccgaggagcgccggctgctggtgacc
gcgatggggcgggcccggcggcggttgctggtgaccgccgtagatagcgacgcgggcggg
ggcgggcacgaggcggtgctgccatcggcgttctttttcgagattgcccagtgggccgac
ggcgatggcgaacccgtcgcgatgcagccggtctcggcgccgcgcgtgttgtcggctgcg
gcggtggtaggccggttacgcgttgtggtgtgcgcgcctgcctgcgcggtagatgacgcc
gatcgcgattgtgcggcaacgcaattggcccggttggccaaagccggtgtgccaggtgcc
gacccgtccgagtggcatggcctggccccggtcagcacgagtgatccgttgtgcgatagc
gacgatctcgtcacgttgacgccgtcgactttgcaggcactcaacgactgcccactgcgc
tggctggccgagcggcacggcggaacaaacacccgcgagctgccgtctgccgtcggatcg
gtgttgcacgcactgtttgccgagccgggcaggagcgaatcccaactgctggctgaactg
gaccgggtgtggggccatctgccgttcggcgctcagtggtattcggccaacgagcttgcc
cggcaccgcgcgatgatccaggcgttcgtacagtggcgagctcagagtcgatccgagctg
accgaagttggcgtggaggtcgacatcgatggggccctcgaggacggtagcggtcaagcc
agaaaaattcggttgcgtggccgggcggatcggctggaacgcgacccggccggccgcctg
gtgatcgtcgacatcaaaaccggcaagacaccggtcagcaaggacgatgcccagcagcac
gcccagctggcgatgtatcagctggcggtggccgaaggcttggtgcgcgccggggacgag
cccggcggtgcccggctggtctatgtcggcaaaagcggggccgctggcgtcgccgaacgc
aaacaggatccactcacaccggccgcgcgcgacgaatggcgcaacctcgtccggcagctg
gccgcggcgacagccggtccccagttcatcgctcggcgcaacgacgggtgcacccactgc
ccgctgcggccgggctgtccggcccacgtccgagggtcggcgccatga

DBGET integrated database retrieval system