KEGG   Mycobacterium tuberculosis CDC1551: MT3757
Entry
MT3757            CDS       T00053                                 

Definition
(GenBank) hypothetical protein
Organism
mtc  Mycobacterium tuberculosis CDC1551
SSDB
Other DBs
NCBI-ProteinID: AAK48121
UniProt: Q8VIW2
LinkDB
Position
4087689..4088606
AA seq 305 aa
MVPMAYSTVDMPDSSTASAVIRATSTRNMVITNIFLSHTRPNCKTSPASPTTSGTMPTHR
NAGKKHSPSGPAISTPARSAAAAAACAASCRTWTASSTMPSASAAPEAAERRANRSTASV
CASWVPGGKSGGLDQAMLGSAPNASRSAARRNTRATAAARPQRWRPRPSTPPSPQPDTRP
ARQGWLRRLAGPRHPSALAAAPGVADARGAASRLAPVPPTGRHRATTPWPATPPPHSQHW
PIGDPVRPQQPGAGQCQPDHQQPSAHASRQQKAQRPGADQLTKQHPEQRQDCQYGRTGPG
TGHPR
NT seq 918 nt   +upstreamnt  +downstreamnt
atggtaccgatggcgtattccacggtggacatgcccgactcgtcgaccgccagcgccgtc
atccgcgccacgagtacacgaaacatggtgatcaccaacatattcctttctcataccagg
ccaaactgcaagacatcaccggccagcccgactactagcgggacaatgcccacacacaga
aacgccggtaagaagcacagtcccagcgggccggcgatcagcacaccggcccgctcggcg
gccgccgcggccgcctgtgcggcgtcgtgccgaacctggacggccagttcgacaatgcca
tcggcgagcgccgcgcccgaagccgccgaacgccgtgccaaccgcagtaccgcatcggtc
tgcgcatcgtgggtgcccggcggcaaatccggcggcctcgaccaggcgatgttggggtcg
gcacccaatgccagcaggtcggcggcccggcgcaacacgcgcgccaccgcggcggcgcga
ccgcagcggtggcggccgcggccgtcgacaccgccatccccgcagccagacacacggcca
gcacgtcaaggctggctgcgacggctagcgggtccgcgacatccgtccgccctagcagca
gcccctggtgtggccgatgcgcgcggggcggcctcccggctcgcgcccgtaccaccgacg
ggccggcaccgagccacaacgccatggccagcaacaccgccgccgcactcacaacactgg
ccgatcggtgatccggtccgaccacagcagcccggcgcaggccagtgtcagcccgaccac
cagcagccatccgcccacgcgtcccgtcagcagaaagctcagcggccgggcgccgatcag
ttgaccaagcagcaccccgagcagcggcaggattgccaatatggccgcactggcccgggc
accggccatccccgctga

DBGET integrated database retrieval system