KEGG   Mycobacterium tuberculosis CDC1551: MT3908Help
Entry
MT3908            CDS       T00053                                 

Definition
(GenBank) acyl-CoA synthase, putative
  KO
K12428  fatty acid CoA ligase FadD32
Organism
mtc  Mycobacterium tuberculosis CDC1551
Brite
KEGG Orthology (KO) [BR:mtc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtc01004]
    MT3908
Lipid biosynthesis proteins [BR:mtc01004]
 Acyl-CoA synthetase
  Unknown
   MT3908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AAK48274
UniProt: Q7D4U9
LinkDB All DBs
Structure
PDB: 

Position
complement(4253476..4255365)
Genome map
AA seq 629 aa AA seqDB search
MAYHNPFIVNGKIRFPANTNLVRHVEKWAKVRGDKLAYRFLDFSTERDGVARDILWSDFS
ARNRAVGARLQQVTQPGDRVAIXCPQNLDYLISFFGALYSGRIAVPLFDPAEPGHVGRLH
AVLDDCAPSTILTTTDSAEGVRKFIRARSAKERPRVIAVDAVPTEVAATWQQPEANEETV
AYLQYTSGSTRIPSGVQITHLNLPTNVVQVLNALEGQEGDRGVSWLPFFHDMGLITVLLA
SVLGHSFTFMTPAAFVRRPGRWIRELARKPGETGGTFSAAPNFAFEHAAVRGVPRDDEPP
LDLSNVKGILNGSEPVSPASMRKFFEAFAPYGLKQTAVKPSYGLAEATLFVSTTPMDEVP
TVIHVDRDELNNQRFVEVAADAPNAVAQVSAGKVGVSEWAVIVDADTASELPDGQIGEIW
LHGNNLGTGYWGKEEESAQTFKNILKSRISESRAEGAPDDALWVRTGDYGTYFKDHLYIA
GRIKDLVIIDGRNHYPQDLECTAQESTKALRVGYAAAFSVPANQLPQTVFDDSHAGLKFD
PEDTSEQLVIVGERAAGTHKLDHQPIVDDIRAAIAVGHGVTVRDVLLVSAGTIPRTSSGK
IGRRACRAAYLDGSLRSGVGSPTVFATSD
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggcgtaccacaacccgttcatcgtgaatggaaagatcaggttcccagccaacaccaac
ctggttcgtcacgtcgaaaagtgggcgaaggttcgtggcgacaagctggcctaccggttc
ctggacttttccaccgaacgagacggtgtcgcgcgcgacatcttgtggtctgacttcagc
gcgcgcaaccgtgcggtgggagcccgcctgcagcaagtcacccagccgggtgaccgcgtc
gccatcmtgtgcccgcagaacctggactacctcatctccttcttcggcgccctctactcc
ggccgcattgcggtgccgttgttcgacccggccgagccggggcacgtcggtcggttacac
gcggtgctcgacgactgtgccccgtcgacgatcctgaccaccaccgactccgccgaaggg
gtccgcaagttcatccgggcccgatcggccaaggagcgcccgcgcgtcattgccgtcgac
gcggtgcccaccgaagtcgccgccacctggcagcagcccgaggccaacgaggaaaccgtc
gcgtacttgcagtacacgtcgggttccacccgcataccgagcggcgtgcagatcacccat
ctgaacctgcccaccaatgtggtgcaggtgctcaatgccctggaaggacaggaaggcgac
cgcggggtcagctggctcccgttcttccacgacatgggtctgatcacggtgctgctggcg
tcggtgctaggccacagcttcacctttatgacgcccgcggcgttcgtgcggcggcccggt
cgctggatccgcgagctcgcccgcaagcccggagaaaccggtggcaccttctctgcggcg
ccgaacttcgcattcgaacacgccgcggtgcgcggtgtgcctcgagacgacgagccgccg
ctggacctgagcaacgtcaagggcatcctcaacggcagcgagccggtgtcgccggcgtcg
atgcgcaagttcttcgaagcatttgcgccgtacggtttgaagcagaccgccgtcaagccg
tcctatgggctagcggaggccacgctgttcgtctcgaccacgccgatggacgaggtgccc
accgtgatccacgtggaccgcgacgagctgaacaaccagcggttcgttgaggtggccgcc
gatgcacccaacgccgtcgcccaggtctctgcgggcaaggtcggggtcagcgaatgggcg
gtcatcgtcgacgccgacacggccagcgaactgccggacggacagatcggtgagatctgg
ctgcacggcaacaacttgggtaccggttattggggcaaagaagaagagtccgcccagacc
ttcaagaacatcctcaaatcgcggatcagcgagtcgcgcgccgagggcgccccagacgac
gcgctgtgggtgcgtaccggcgactacggcacctacttcaaggaccacctctacatagcc
ggccggatcaaggacctcgtcatcatcgacggccgcaatcactacccacaggatctcgag
tgcacggcgcaggagtcgaccaaggcgttgcgggttggctacgcggcggccttctcggtt
ccggccaaccagcttcctcagacagtgttcgacgactcgcacgccgggctgaaattcgac
cccgaggacacctccgagcagctggtgatcgtcggcgaacgggcggccggcacgcataag
ctcgaccaccagcccatcgtcgatgacatccgggcggccatcgccgtcgggcatggggtg
accgtgcgtgacgtcctgctggtgtcggccggcacgattccgcgaacctccagcggcaag
atcggccgccgcgcctgccgtgcggcctacctcgacggcagcctgcgcagtggcgtgggt
tccccgacggtcttcgccacttcggactga

DBGET integrated database retrieval system