KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0015Help
Entry
CCDC5079_0015     CDS       T01991                                 

Definition
(GenBank) transmembrane serine/threonine-protein kinase A pknA
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Brite
KEGG Orthology (KO) [BR:mte00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mte01001]
    CCDC5079_0015
Enzymes [BR:mte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CCDC5079_0015
Protein kinases [BR:mte01001]
 Serine/threonine kinases: Other
  Bacterial family
   CCDC5079_0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Haspin_kinase RIO1 Kinase-like ABC1
Motif
Other DBs
NCBI-ProteinID: AEJ45205
LinkDB All DBs
Structure
PDB: 

Position
complement(18345..19622)
Genome map
AA seq 425 aa AA seqDB search
MTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRAEARTTA
MLNHPGIASVHDYGESQMNGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALDMLEQTG
RALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAP
EQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPPDLPPNVR
ELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQTPPPGRAAPAAIPSGTTARVA
ANSAGRTAASRRSRPATGGHRPPRRTFSSGQRALLWAAGVLGALAIIIAVLLVIKAPGDN
SPRPAPTPTVTTTGNPPASNTGGTDPSPRLNWTERGETRHSGLQSWVVPPTPHSRASLAR
YEIAQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgtcgggcagataccgcctgcagcgcctcatcgccaccggtggtatgggccaa
gtctgggaggccgtggataaccggttgggccggcgtgttgcggtgaaggtgctcaagagc
gagttctcctccgatccggagttcatcgaacggttccgggccgaagcgcgcaccaccgcg
atgctgaaccatccgggcatcgccagcgtgcacgactacggcgaaagccagatgaacggg
gagggtcgcacggcctacctggtgatggagctggtcaacggcgagccactaaattcggtg
ctcaaacgcaccggccggctgtcgttgcggcacgcactggacatgctcgagcagaccggc
cgcgctctgcagatcgcgcatgccgctggcctggtgcaccgcgacgtcaaaccgggcaac
atcttgatcacccccaccgggcaggtgaagatcaccgacttcggcatcgccaaagccgtc
gatgcagcgcccgtgacccagaccggcatggtgatgggcaccgcccaatacatcgcgccg
gagcaggccctcggtcacgacgccagcccggccagcgacgtctattcactgggagttgtt
gggtatgaagcggtttcgggtaaacggccgttcgccggcgatggtgccctgaccgtggca
atgaagcacatcaaggagccgccgccgccgctgcctcccgacctgccgcccaatgtgcga
gaactcatcgagataactctggtgaagaaccccgcgatgcgctatcgcagtgggggaccg
ttcgccgacgcggtggcagcggtgcgcgccggccgccggcccccgcggcccagccagaca
cccccccctggccgggccgccccggcggccattccgtcgggtacgacagccagggtcgcg
gccaactctgctggccggactgcggcatcccgtcgatcccgcccggccacgggtggtcac
cggccgccgcggcgcacgttttcgtccggtcagcgtgcgctgctctgggccgcgggggtg
ctgggggcgctggcaatcatcatcgccgtgctgctcgtcatcaaagcgcccggggacaac
agcccgcggccggcaccgacgccgaccgtgaccaccaccgggaaccctccggccagcaac
actggcgggactgatcctagcccgcgactcaattggacggaacgcggggaaacacgtcat
tctggactgcaaagctgggttgtcccgccgacaccgcattcgcgcgcgtcgctggcccga
tacgagatagcgcaatga

DBGET integrated database retrieval system