KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0207Help
Entry
CCDC5079_0207     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_0207
   00650 Butanoate metabolism
    CCDC5079_0207
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0207
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0207
   00310 Lysine degradation
    CCDC5079_0207
   00360 Phenylalanine metabolism
    CCDC5079_0207
   00380 Tryptophan metabolism
    CCDC5079_0207
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_0207
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_0207
   00281 Geraniol degradation
    CCDC5079_0207
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_0207
   00627 Aminobenzoate degradation
    CCDC5079_0207
   00930 Caprolactam degradation
    CCDC5079_0207
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-ProteinID: AEJ45397
LinkDB All DBs
Structure
PDB: 

Position
263137..263925
Genome map
AA seq 262 aa AA seqDB search
MSSESDAANTEPEVLVEQRDRILIITINRPKAKNAVNAAVSRGLADAMDQLDGDAGLSVA
ILTGGGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPTKPLIAAVEGYALAGGTELALA
ADLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDNLPAERAHELGL
VNVLAEPGTALDAAIALAEKITANGPLAVVATKRIITESRGWSPDTMFAEQMKILVPVFT
SNDAKEGAIAFAERRRPRWTGT
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgaaagcgacgcagccaacaccgaacctgaggttctggtcgaacagcgggat
cggattttgatcatcacgatcaaccgcccgaaagccaagaacgcggtcaacgccgcagtc
agccggggcttggccgatgcgatggatcagcttgacggcgatgccggcctgtcggtggca
atcctgaccggtgggggcggttcgttctgcgcgggcatggacctcaaggcgttcgcccgg
ggcgagaatgtcgtcgtcgaaggtcgcggccttggctttaccgaacgtccgccgaccaag
ccgctcattgctgcggtggaaggctacgcgttggcgggtggcaccgagctggcgcttgct
gccgacctgatcgtggcggccagggattcggcgttcgggattcctgaagtcaagcggggt
ctggttgccggcggcgggggattgctgcggttgccggagcgcatcccgtatgcgatagcc
atggagttggcgctgaccggtgacaacctaccggccgaacgcgcgcacgagctggggctc
gtcaacgttttggccgagccggggaccgccctcgatgctgcgatcgcgttggcggagaag
atcaccgccaatgggccgctggcggtggtggccaccaagcggattatcaccgagtcgcgt
gggtggagtcccgacactatgttcgctgagcagatgaagatcctggtgccggtgttcacc
tccaacgacgcgaaggaaggtgcgatcgcgttcgccgagaggcgccggccccgttggacg
ggcacctag

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0428Help
Entry
CCDC5079_0428     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_0428
   00650 Butanoate metabolism
    CCDC5079_0428
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0428
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0428
   00310 Lysine degradation
    CCDC5079_0428
   00360 Phenylalanine metabolism
    CCDC5079_0428
   00380 Tryptophan metabolism
    CCDC5079_0428
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_0428
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_0428
   00281 Geraniol degradation
    CCDC5079_0428
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_0428
   00627 Aminobenzoate degradation
    CCDC5079_0428
   00930 Caprolactam degradation
    CCDC5079_0428
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ45618
LinkDB All DBs
Position
complement(543470..544384)
Genome map
AA seq 304 aa AA seqDB search
MPTPDFQTLLYTTAGPVATITLNRPEQLNTIVPPMPDEIEAAIGLAERDQDIKVIVLRGA
GRAFSGGYDFGGGFQHWGDAMMTDGRWDPGKDFAMVTARETGPTQKFMAIWRASKPVIAQ
VHGWCVGGASDYALCADIVIASEDAVIGTPYSRMWGAYLTGMWLYRLSLAKVKWHSLTGR
PLTGVQAAEAELINEAVPFERLEARVAEIATELARIPLSQLQAQKLIVNQAYENMGLAST
QLLGGILDGLMRNTPDALEFIRTAQTQGVRAAVERRDGPFGDYSQAPPELRPDPTHVITP
DGSM
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccgacacccgatttccagacgctgctgtacacgacggccgggccggtggccaccatc
acgctcaaccgcccggaacagctcaacaccatcgtcccgcccatgcccgacgagatcgag
gccgctatcgggttggccgagcgcgaccaggacatcaaggtcatcgtgctgcgcggtgcc
ggccgcgccttctccggcggttacgacttcggcggcggcttccagcattggggcgatgcc
atgatgaccgacggccgatgggatccgggcaaggatttcgccatggtcaccgcgcgggag
accggaccgacgcagaaattcatggccatctggcgggcgtccaaaccggtgatcgcgcaa
gtgcatggttggtgcgtcggcggggccagcgactacgcgctgtgtgccgacattgtgatc
gccagcgaggacgccgtgatcgggaccccgtatagccgcatgtggggagcctatttgacc
gggatgtggctgtatcgactcagccttgccaaggtcaaatggcactcgctgacgggccgg
ccgctgaccggtgtgcaggccgccgaagccgagctgatcaacgaggcggtgccgttcgag
cggctcgaggctcgcgtcgccgagatcgccaccgagctggcacgaatcccgttgtcacag
ttgcaagcccagaaactgatcgtcaaccaggcctacgagaacatgggcctggcctccacc
cagctgctgggcggcattctcgacgggctgatgcgcaacacccccgacgcgctcgagttc
atccggaccgcccaaacccagggtgtgcgagccgcggtcgagcgccgcgacggcccgttc
ggcgactacagccaagccccaccggaactgcgacccgaccccacgcacgtcatcactcct
gatgggagcatgtag

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0589Help
Entry
CCDC5079_0589     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_0589
   00650 Butanoate metabolism
    CCDC5079_0589
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0589
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0589
   00310 Lysine degradation
    CCDC5079_0589
   00360 Phenylalanine metabolism
    CCDC5079_0589
   00380 Tryptophan metabolism
    CCDC5079_0589
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_0589
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_0589
   00281 Geraniol degradation
    CCDC5079_0589
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_0589
   00627 Aminobenzoate degradation
    CCDC5079_0589
   00930 Caprolactam degradation
    CCDC5079_0589
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 CLP_protease Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEJ45779
LinkDB All DBs
Structure
PDB: 

Position
complement(726153..726848)
Genome map
AA seq 231 aa AA seqDB search
MSDPVSYTRKDSIAVISMDDGKVNALGPAMQQALNAAIDNADRDDVGALVITGNGRVFSG
GFDLKILTSGEVQPAIDMLRGGFELAYRLLSYPKPVVMACTGHAIAMGAFLLSCGDHRVA
AHAYNIQANEVAIGMTIPYAALEIMKLRLTRSAYQQATGLAKTFFGETALAAGFIDEIAL
PEVVVSRAEEAAREFAGLNQHAHAATKLRSRADALTAIRAGIDGIAAEFGL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacccggtcagctatacccgcaaggattccatcgccgtcatcagtatggacgac
ggcaaggtcaacgcactgggcccggcgatgcaacaagccctcaatgcagcgatcgacaac
gcggaccgtgatgatgttggggcgctggtgatcaccggtaatggccgggtattcagcgga
ggcttcgacctgaagatcctcacctccggtgaagtgcagcccgcgatcgacatgctcagg
ggcggcttcgagctggcgtatcgcctcttgtcctaccccaaaccggtggtgatggcgtgc
accggtcacgccatcgccatgggcgcgtttctgttgtcctgcggcgatcatcgggtggcg
gcccacgcatacaacatccaggccaatgaggtcgcgatcggcatgaccattccgtacgcg
gcgttagagatcatgaagctgcgactgacccggtcggcataccagcaggcaaccgggctg
gccaagacgttcttcggggaaaccgcgctggccgccgggtttatcgacgagatcgccctg
ccggaggtggtggtcagccgcgccgaggaagccgcacgagagttcgccggtctcaaccaa
cacgcccatgccgcgaccaagttgcgctcccgcgccgacgcgctcactgcgattcgggcc
gggatcgacgggatagcagccgagttcgggctgtaa

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0625Help
Entry
CCDC5079_0625     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_0625
   00650 Butanoate metabolism
    CCDC5079_0625
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0625
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0625
   00310 Lysine degradation
    CCDC5079_0625
   00360 Phenylalanine metabolism
    CCDC5079_0625
   00380 Tryptophan metabolism
    CCDC5079_0625
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_0625
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_0625
   00281 Geraniol degradation
    CCDC5079_0625
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_0625
   00627 Aminobenzoate degradation
    CCDC5079_0625
   00930 Caprolactam degradation
    CCDC5079_0625
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah ACP_syn_III_C DUF3756
Motif
Other DBs
NCBI-ProteinID: AEJ45815
LinkDB All DBs
Position
770694..771632
Genome map
AA seq 312 aa AA seqDB search
MTHAIRPVDFDNLKTMTYEVTGRIARITFNRPEKGNAIIADTPLELSALVERADLDPGVH
VILVSGRGEGFCAGFDLSAYAEGSSSTGGGGAYQGTVLDGKTQAVNHLPNQPWDPMIDYQ
MMSRLVRGFASLMHADKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVP
AAGLWAHRLGDQRAKRLLFTGDCITGAQAAEWGLAVEAPEPADLDERTERLVARIAALPV
NQLIMVKLALNSALLQQGVATSRMVSTVFDGAARHTPEGHAFVADAVEHGFRDAVRRRDE
PFGDYGRQASRV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgcgatcaggccggtcgatttcgacaacctgaagacgatgacctatgaggtc
accggtcggattgcgcggatcaccttcaaccggccggagaagggcaacgcgatcatcgca
gacaccccgctggagttgtctgctctggtggagcgtgccgatctggatccaggcgtgcat
gtcattctggtgtccggtcgcggcgagggattctgtgccggcttcgacctgtccgcctac
gccgaggggtcgtcgtcgaccgggggcggcggcgcataccaaggcacggtgctagatggc
aagacccaggccgtcaaccacctaccgaaccagccgtgggacccgatgatcgactaccag
atgatgagccggttagtgcgcggattcgccagtctgatgcatgccgacaagccgacggtg
gtcaagatccacggctactgcgtggccggcggcaccgacatcgcgctgcacgccgatcag
gtgatcgccgccgccgacgccaagatcggctacccgcccacccgggtgtggggggtgccg
gcggcgggcctgtgggcgcaccggctcggcgaccagcgggccaaacggctgctgttcacc
ggcgattgcatcaccggcgcgcaggccgccgagtggggcctggcggtcgaggcgccggag
ccggctgacctcgacgagcggaccgagcgactggtggcccggatcgccgcactgccggtc
aatcaattgatcatggtcaagctcgcgctcaattccgctctgctgcaacagggtgtggcc
accagcaggatggtcagcaccgtgttcgacggcgccgctcggcacacacccgaggggcac
gcgtttgtcgccgacgcggtcgagcacggcttccgggatgcggtgcggcgccgtgacgag
ccgtttggcgactacggccgtcaagcatcgcgggtgtaa

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0627Help
Entry
CCDC5079_0627     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_0627
   00650 Butanoate metabolism
    CCDC5079_0627
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0627
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0627
   00310 Lysine degradation
    CCDC5079_0627
   00360 Phenylalanine metabolism
    CCDC5079_0627
   00380 Tryptophan metabolism
    CCDC5079_0627
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_0627
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_0627
   00281 Geraniol degradation
    CCDC5079_0627
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_0627
   00627 Aminobenzoate degradation
    CCDC5079_0627
   00930 Caprolactam degradation
    CCDC5079_0627
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEJ45817
LinkDB All DBs
Structure
PDB: 

Position
772354..773145
Genome map
AA seq 263 aa AA seqDB search
MSDLVRVERKGRVTTVILNRPASRNAVNGPTAAALCAAFEQFDRDDAASVAVLWGAGGTF
CAGADLKAFGTPEANSVHRTGPGPMGPSRMMLSKPVIAAVSGYAVAGGLELALWCDLRVA
EEDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRGVPADEALAMGLANRVVP
KGQARQAAEELAAQLAALPQQCLRSDRLSALHQWGLPESAALDLEFASIARVAGEALEGA
RRFAAGAGRHGAPAPRAEQGDTL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctggtgcgtgtggagcgcaaaggtcgggtgaccacggtgattctgaaccgg
ccggcctcccgcaacgcggtcaacggcccgaccgccgcggcgttgtgcgcggcgttcgag
caattcgaccgggacgacgccgcgtcggtggccgtactctggggtgcgggtggaaccttt
tgtgcgggagccgatttgaaggcctttggcacaccggaggccaactctgtgcaccggacg
ggtcccggcccgatggggccgtcacgaatgatgctgtccaaacctgtgatcgccgccgtc
agcggctacgccgtcgccggggggctggaattggcactgtggtgcgacctgcgggtggcc
gaggaagacgccgtgttcggtgtgttttgccgtcgctggggggtaccgctcatcgacggc
ggcaccgtgcgactgccacggctgatcgggcacagccgcgcgatggacatgatcctcact
ggccgtggggtgccggccgacgaagcgctggccatggggttggccaatcgggtggtgccc
aagggtcaagcccgacaggcggctgaggagttggcggcgcaattggccgcgctgccgcag
cagtgtctgcgatcggatcggctgtcggcgctgcaccagtggggcctgcccgagtccgcg
gcgctcgacctcgagttcgccagcatcgcgcgggtggccggcgaggcgctagagggggcg
agacggttcgccgcgggtgccggtcggcatggggccccggcacctcgggccgaacagggc
gacacgctttag

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0795Help
Entry
CCDC5079_0795     CDS       T01991                                 

Definition
(GenBank) fatty oxidation protein fadB
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01200  Carbon metabolism
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_0795
   00650 Butanoate metabolism
    CCDC5079_0795
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0795
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0795
   00310 Lysine degradation
    CCDC5079_0795
   00380 Tryptophan metabolism
    CCDC5079_0795
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_0795
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_0795
   00281 Geraniol degradation
    CCDC5079_0795
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_0795
   00930 Caprolactam degradation
    CCDC5079_0795
Enzymes [BR:mte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CCDC5079_0795
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_0795
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CCDC5079_0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEJ45985
LinkDB All DBs
Structure
PDB: 

Position
952504..954666
Genome map
AA seq 720 aa AA seqDB search
MPDNTIQWDKDADGIVTLTMDDPSGSTNVMNEAYIESMGKAVDRLVAEKDSITGVVVASA
KKTFFAGGDVKTMIQARPEDAGDVFNTVETIKRQLRTLETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSQLGLPEVTLGLLPGGGGVTRTVRMFGIQNAFVSVLAQGTRFKPAK
AKEIGLVDELVATVEELVPAAKAWIKEELKANPDGAGVQPWDKKGYKMPGGTPSSPGLAA
ILPSFPSNLRKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFASLVTGQVAKNMM
QAFFFDLQAINAGGSRPEGIGKTPIKRIGVLGAGMMGAGIAYVSAKAGYEVVLKDVSLEA
AAKGKGYSEKLEAKALERGRTTQERSDALLARITPTADAADFKGVDFVIEAVFENQELKH
KVFGEIEDIVEPNAILGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEK
TSDEALARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVEPASIEQAGS
QAGYPAPPLQLSDELNLELMHKIAVATRKGVEDAGGTYQPHPAEAVVEKMIELGRSGRLK
GAGFYEYADGKRSGLWPGLRETFKSGSSQPPLQDMIDRMLFAEALETQKCLDEGVLTSTA
DANIGSIMGIGFPPWTGGSAQFIVGYSGPAGTGKAAFVARARELAAAYGDRFLPPESLLS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaacacaatccagtgggacaaggatgccgacggcatcgtcacgctgaccatg
gacgatccctccgggtcaaccaacgtgatgaacgaggcctacatcgagtcgatgggcaag
gccgtcgatcgccttgtcgccgaaaaggattcgatcaccggagtggtagtcgccagcgcg
aagaaaaccttcttcgccggcggcgacgtcaagacgatgatccaggccaggcccgaggac
gccggcgatgtattcaacaccgtcgagaccatcaagcggcagctgcgcaccttggagaca
ttgggtaagccggtcgtcgcggccatcaacggggcggcgttgggcggcggcctggagatc
gcgctggcgtgtcatcaccggatcgccgccgacgtcaagggcagccagctcggtctgccg
gaggtgacgctgggtctgctgccgggtggcggtggggtgacccgcacggtacggatgttc
ggcatccagaacgcgttcgtgagcgtgctggcgcaaggtacccggttcaagccggccaag
gccaaggagatcggtctggtcgacgagctggtggcaacggtcgaggagctggtgcccgcc
gccaaggcttggataaaggaggagctcaaggccaaccccgacggtgccggggtgcagccg
tgggacaagaagggctacaagatgcccggcggcaccccgtcgtcgccgggtctggcggcg
attttgccgtcgttcccgtcgaacctgcgcaagcagctcaagggtgccccgatgccggcg
ccgcgggccatcctggccgccgcggtcgagggggcacaggtcgacttcgacaccgccagc
cgcatcgagagccgctacttcgcgtcgttggtcaccggccaggtcgccaagaacatgatg
caggcgttcttcttcgacctgcaggccatcaatgccggcgggtctcggcccgaaggcatc
ggcaagaccccgatcaagaggatcggtgtgctgggtgcgggcatgatgggcgccggcatc
gcctacgtctctgccaaggccggctatgaggtggtactcaaagatgtcagccttgaggcc
gccgctaaaggcaagggctactccgaaaagctggaggccaaggcgctggagcggggccgc
accacacaggagcgcagcgacgccctgctggcgcgcatcaccccgaccgccgacgccgcc
gatttcaagggcgttgatttcgtgatcgaggcggtttttgaaaaccaggagctcaagcac
aaggtgttcggcgagatcgaagacatcgtcgagcccaacgcgatcctgggatccaacacc
tcgacgctgccgatcaccggtctggcgaccggcgtcaagcggcaggaagactttatcggg
atccacttcttctcgccggtcgacaagatgccgctggtggagatcatcaagggcgagaag
acttctgacgaggccctggcccgggtgttcgactacaccttggccatcggcaagaccccg
atcgtggtcaacgacagccgcggctttttcacctcgcgggtcatcggcacgttcgtcaac
gaggcgctggcgatgctcggtgagggtgtcgagccggcttctatcgagcaggcggggtcg
caggccgggtatccggcgccgccgctgcagctgtccgacgagctcaacttggagctgatg
cacaagatcgccgtcgccacccgtaagggtgttgaggacgccggcggcacgtaccagccg
catccggcggaggccgtggtggagaagatgatcgagctcggccggtccggccggctgaag
ggcgcgggcttctacgagtacgccgacggcaagcgatccgggttgtggcccggcttgcgc
gagacgttcaagtcgggctcgtcgcagccgccgctgcaggacatgatcgaccgcatgctg
ttcgccgaggcgctggaaacccagaagtgcctcgacgagggggtgctgacgtcgacggcc
gacgccaacatcggctcgatcatgggcatcggcttcccgccgtggacaggtggcagtgcc
cagttcatcgtcggctactccggcccggccggtaccggtaaggcggctttcgtggcccgg
gcccgcgagctggcggccgcctacggcgaccgcttcctgccgccggagtcgctgctaagc
tga

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0836Help
Entry
CCDC5079_0836     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_0836
   00650 Butanoate metabolism
    CCDC5079_0836
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0836
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0836
   00310 Lysine degradation
    CCDC5079_0836
   00360 Phenylalanine metabolism
    CCDC5079_0836
   00380 Tryptophan metabolism
    CCDC5079_0836
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_0836
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_0836
   00281 Geraniol degradation
    CCDC5079_0836
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_0836
   00627 Aminobenzoate degradation
    CCDC5079_0836
   00930 Caprolactam degradation
    CCDC5079_0836
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ46026
LinkDB All DBs
Structure
PDB: 

Position
1004441..1005172
Genome map
AA seq 243 aa AA seqDB search
MIGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLTGQGTAFCAGA
DLSGDAFAADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQ
FPTSKYGLALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLADAQAW
AAEIARLAPLAIQHAKRVLNDDGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKF
QGA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtatcacccaggcagaagccgtgctgaccattgagctgcaacgcccggagcgc
cgcaacgccttaaattcccagctggtcgaggagcttacgcaggccatccggaaagccggg
gatggatcggctcgggcgatcgtgctgaccggccaaggcaccgcgttctgcgctggcgcg
gacctgagcggagacgcattcgccgccgattatcccgaccggctcatcgagctgcacaag
gcgatggacgcctccccgatgccagtggtcggcgcgatcaacggtcccgccatcggcgcc
ggcttgcagcttgccatgcaatgcgacctgcgggttgtcgcgcccgatgccttcttccag
tttccgacgtcgaaatacggtctggccctggataactggagcatccgccggctgtcgtcg
ttggttgggcacggacgtgcccgcgcgatgctgctcagcgcggaaaagctgaccgccgag
atcgcactgcacaccggaatggcgaatcgcattggcactttggccgacgcccaggcctgg
gccgccgagatcgccaggctggcaccactggctatccagcacgccaagcgggtgctcaac
gacgacggcgctatcgaggaagcgtggccggcccataaggaactcttcgacaaagcctgg
ggcagccaggatgtcatcgaagcgcaggttgcccggatggaaaagcggccgccgaagttc
caaggggcttaa

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0896Help
Entry
CCDC5079_0896     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_0896
   00650 Butanoate metabolism
    CCDC5079_0896
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0896
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0896
   00310 Lysine degradation
    CCDC5079_0896
   00360 Phenylalanine metabolism
    CCDC5079_0896
   00380 Tryptophan metabolism
    CCDC5079_0896
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_0896
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_0896
   00281 Geraniol degradation
    CCDC5079_0896
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_0896
   00627 Aminobenzoate degradation
    CCDC5079_0896
   00930 Caprolactam degradation
    CCDC5079_0896
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_0896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ46086
LinkDB All DBs
Position
complement(1078013..1078822)
Genome map
AA seq 269 aa AA seqDB search
MDSPVDYAGPAACGGPFARLTLNSPHNRNALSSTLVSQLHQGLSAAEADPAVRLVVLGHT
GGTFCAGADLSEAGGGGGDPYRMAVARAREMTALLRAIVESPLPVVGAINGHVRAGGFGL
VGACDMVVAGPESTFALTEARIGVAPAIISLTLLPKLSPRAAARYYLTGEKFGAREAADI
GLITMAADDVDAAVAALVADVGRGSPQGLAASKALTTAAVLEGFDRDAERLTEESARLFV
SDEAREGMLAFLQKRPPRWVQPATMRAAD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggacagccccgtcgactacgctggcccggccgcctgcggcggccccttcgccaggctg
acactgaactctccgcacaaccgcaacgcgctgtcgagcacgctggtcagccaactacat
caagggctgagtgcggccgaagcagatccggcggtgcggctggtcgtgctggggcatacc
ggcggaacgttctgcgccggcgcggacctcagcgaggccggcggtggtggtggtgatccg
taccggatggcggtggcgcgggcgcgggaaatgacggcgctgttgcgcgccatcgtcgag
tcgccgctgccggtggtcggcgccatcaacgggcatgtgcgggccggcgggttcggcctg
gtcggtgcgtgcgacatggtggtcgccggaccggaaagcacgttcgcgctgaccgaggca
cggatcggggtggcaccggcgatcatctcgctgacgctgctgcccaagctttcgccgcgc
gccgcggcccgctattacctgaccggcgagaagttcggcgcccgcgaagccgccgacatc
ggactgatcaccatggcggccgacgacgtggacgccgcggtggccgcgctggtcgccgac
gtgggccgcggctcgccacaaggcctggccgcgtcgaaggcgctgaccacggccgccgtg
ctcgaagggttcgaccgcgacgccgaacgcctgaccgaggagtcggccaggctgttcgtc
tccgacgaagcgcgcgaagggatgctggccttcctgcagaaacgtccgccccgctgggtc
cagccggcgacgatgcgggccgctgactag

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0988Help
Entry
CCDC5079_0988     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_0988
   00650 Butanoate metabolism
    CCDC5079_0988
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0988
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0988
   00310 Lysine degradation
    CCDC5079_0988
   00360 Phenylalanine metabolism
    CCDC5079_0988
   00380 Tryptophan metabolism
    CCDC5079_0988
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_0988
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_0988
   00281 Geraniol degradation
    CCDC5079_0988
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_0988
   00627 Aminobenzoate degradation
    CCDC5079_0988
   00930 Caprolactam degradation
    CCDC5079_0988
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF218 TetR_C_21
Motif
Other DBs
NCBI-ProteinID: AEJ46178
LinkDB All DBs
Structure
PDB: 

Position
complement(1190501..1191274)
Genome map
AA seq 257 aa AA seqDB search
MTYETILVERDQRVGIITLNRPQALNALNSQVMNEVTSAATELDDDPDIGAIIITGSAKA
FAAGADIKEMADLTFADAFTADFFATWGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLI
AADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVV
PADDLLTEARATATTISQMSASAARMAKEAVNRAFESSLSEGLLYERRLFHSAFATEDQS
EGMAAFIEKRAPQFTHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacgaaaccatcctggtcgagcgcgatcagcgagttggcattatcacgctgaac
cgtccccaggcactgaacgcgctcaacagccaggtgatgaacgaggtcaccagcgctgca
accgaactggacgatgacccggacattggggcgatcatcatcaccggttcggccaaagcg
tttgccgccggagccgacatcaaagaaatggccgacctgacgttcgccgacgcgttcacc
gccgacttcttcgccacctggggcaagctggccgccgtgcgcaccccgacgatcgccgcg
gtggcgggatacgcgctcggcggtggctgcgagctggcgatgatgtgcgacgtgctgatc
gccgccgacaccgcgaagttcggacagcccgagataaagctgggcgtgctgccaggcatg
ggcggctcccagcggctgacccgggctatcggcaaggctaaggcgatggacctcatcctg
accgggcgcaccatggacgccgccgaggccgagcgcagcggtctggtttcacgggtggtg
ccggccgacgacttgctgaccgaagccagggccactgccacgaccatttcgcagatgtcg
gcctcggcggcccggatggccaaggaggccgtcaaccgggctttcgaatccagtttgtcc
gaggggctgctctacgaacgccggcttttccattcggctttcgcgaccgaagaccaatcc
gaaggtatggcagcgttcatcgagaaacgcgctccccagttcacccaccgatga

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0989Help
Entry
CCDC5079_0989     CDS       T01991                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_0989
   00650 Butanoate metabolism
    CCDC5079_0989
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0989
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0989
   00310 Lysine degradation
    CCDC5079_0989
   00360 Phenylalanine metabolism
    CCDC5079_0989
   00380 Tryptophan metabolism
    CCDC5079_0989
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_0989
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_0989
   00281 Geraniol degradation
    CCDC5079_0989
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_0989
   00627 Aminobenzoate degradation
    CCDC5079_0989
   00930 Caprolactam degradation
    CCDC5079_0989
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AEJ46179
LinkDB All DBs
Position
complement(1191286..1192323)
Genome map
AA seq 345 aa AA seqDB search
MTGESHEVLTNVEGGVGFVTLNRPKAINSLNQTMVDLLATVLMSWEHEDAVHAVVLSGAG
ERGLCAGGDVVAVYHSARKDGVEARRFWRHEYLLNALIGRFAKPYVALMDGIVMGGGVGV
SAHANTRVVTDTSKVAMPEVGIGFIPDVGGVYLLSRAPGALGLHAALTGAPFSGADAIAL
GFADHFVPHGDLDAFTQKIVTGGVESALAAHAVEPPPSTLAAQRDWIDECYAGDSVADIV
AALRKQGGEPAVNASDLIASRSPIALSVTLQAVRRAAKLDTLEDVLIQDYRVSSASLRSH
DLVEGIRAQLIDKDRNPNWSPATLDAITAADIEAYFEPVDDDLSF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcgaatcgcatgaggtcctgacaaacgtcgagggcggtgtcggattcgtgacg
ctcaaccgccccaaggcgatcaactcactgaaccaaaccatggtcgacctgctggccaca
gtgctcatgagctgggagcatgaggacgcggtgcacgcggtggtgctctccggagccggc
gaacgcggactttgcgccggcggggacgtggtggccgtctaccacagtgcccgcaaggac
ggggtcgaggcgcggcggttctggcgccacgagtatctgctcaacgccctgatcggccgg
ttcgccaagccctacgtggcgttgatggacggcatcgtaatgggcggcggcgtcggcgtc
agcgcacacgcgaacacccgggtggttaccgatacctccaaggtcgcgatgcccgaagtg
ggcatcgggttcatccccgacgtcggcggggtgtatttgctgtcgcgtgcacccggcgcg
ctgggtctgcacgccgccctgactggagcgccgttttccggcgccgacgccatcgcgctg
ggattcgccgaccacttcgtgccacacggcgacctcgatgcgttcacgcagaagatcgtc
accggcggcgtggagagcgcattggccgcccacgccgtcgaacctccaccgagcacgctt
gccgcccaacgtgattggatcgacgaatgctatgccggcgacagcgtcgccgacatcgtt
gcggcgctgcggaaacagggcggcgaaccagccgtaaatgcttccgacctgattgccagc
cgctcccccatcgcgctgtcggtgacgttgcaggcagtgcgtcgcgccgccaaactcgac
acgctagaagacgtgttgatccaggactatcgggtgtcatcggcgtcgctgcgctcgcat
gacctggtggagggcatccgcgcgcagttgatcgacaaggatcgcaacccgaactggtcg
ccggcaaccctggacgcgatcacggcggccgacatcgaagcctatttcgaaccggtcgac
gatgacttgagtttctag

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1054Help
Entry
CCDC5079_1054     CDS       T01991                                 

Definition
(GenBank) hypothetical protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_1054
   00650 Butanoate metabolism
    CCDC5079_1054
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_1054
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_1054
   00310 Lysine degradation
    CCDC5079_1054
   00360 Phenylalanine metabolism
    CCDC5079_1054
   00380 Tryptophan metabolism
    CCDC5079_1054
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_1054
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_1054
   00281 Geraniol degradation
    CCDC5079_1054
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_1054
   00627 Aminobenzoate degradation
    CCDC5079_1054
   00930 Caprolactam degradation
    CCDC5079_1054
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 YdjM
Motif
Other DBs
NCBI-ProteinID: AEJ46244
LinkDB All DBs
Position
complement(1265793..1266599)
Genome map
AA seq 268 aa AA seqDB search
MPDSGIAALTPVTGLNVTLTDRVLSVRINRPSSLNSLTVPILTGIADTLERAAADPVVKV
VRLGGVGRGFSSGVSMSVDDVWGGGPPTAIVEEANRAVRAVAALPHPVVAVVQGPAVGVA
VSLALACDFILASDSAFFMLANTKVALMPDGGASALVAAATGRIRAMRLALLAEQLPARE
ALAWGLISAVYPDSDFEAEVDKVISRLLAGPALAFAQAKNAINAAALTELEPTFARELDG
QEVLLRTHDFAEGAAAFLQRRTPNFTGS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgccagattccgggattgccgcattaacgccggtcacaggcctcaacgtcaccctgacc
gacagagtgttgtcggtgcgcatcaaccgccctagcagtctcaactcgctgaccgtgcca
atcctgacggggatcgccgacacgctggagcgcgcggcggccgatcccgtggtcaaggtg
gtgcgcctaggcggggtgggccgcggtttcagctccggagtgtctatgtctgtggacgat
gtgtggggcggagggccgccgaccgccatcgtcgaagaggccaaccgcgcagtacgcgcc
gtggccgcgctaccgcacccggttgtagctgtcgttcaaggaccagcggtcggcgtcgct
gtctcgctagcgctggcgtgtgacttcatattggcttctgatagtgcatttttcatgctc
gccaacaccaaggtagcgttgatgcccgacggcggcgcatcggcgttagtcgccgcggcc
accggccggatccgggcgatgcggctggcgctgctggccgagcaactgccggcccgcgag
gcactggcctggggcctgatcagcgcggtatatccggacagcgacttcgaggccgaggtg
gacaaggtgatttcacggttgctggccggcccggcgctggcgttcgcccaggccaaaaac
gccatcaatgcagccgccctcaccgaattggaacccacgttcgcgcgcgaattggatgga
caggaagtcctgctgcgaacacacgacttcgccgagggcgcagcggcgttcctgcaacgc
cgcacccccaacttcaccggttcctga

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1055Help
Entry
CCDC5079_1055     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_1055
   00650 Butanoate metabolism
    CCDC5079_1055
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_1055
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_1055
   00310 Lysine degradation
    CCDC5079_1055
   00360 Phenylalanine metabolism
    CCDC5079_1055
   00380 Tryptophan metabolism
    CCDC5079_1055
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_1055
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_1055
   00281 Geraniol degradation
    CCDC5079_1055
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_1055
   00627 Aminobenzoate degradation
    CCDC5079_1055
   00930 Caprolactam degradation
    CCDC5079_1055
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ46245
LinkDB All DBs
Position
complement(1266742..1267548)
Genome map
AA seq 268 aa AA seqDB search
MSNYRIDTRTIVPGLAVTLADGVLSVTIDRPESLNSLTKPVLAGMADAIEGAATDPRVKV
VRLGGAGRGFSSGGAISVDDVWASGPPTDTVAEANRTVRAIVALPQPVVAVVQGPTVGCG
VSLALACDLVLASDNAFFMLAHTNVGLMPDGGASALVQAAIGRIRAMHMALLPDRVPAAE
ALSWGLVSAVYPAADFDAEVDKLISRLLAGPALAIAKTKNAINAATLTELAPTLLRELDG
QALLLRTDDFAEGATAFQQRRTPMFTGR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaactaccggatcgacactcggacaattgtcccgggtctcgccgtcaccctggcc
gacggggtgctgtcggtgaccatcgatcgcccggagagtctcaactcgctgaccaagccg
gtgctggcagggatggccgacgcgatcgagggcgcggccaccgacccacgggtgaaggtg
gtgcgcctcgggggcgccggtcgcggcttcagctccggaggggcaatcagcgttgacgat
gtgtgggccagtggcccgcctaccgacaccgtcgcggaggccaaccgcacggtgcgtgcc
attgtggcactaccacaaccggtcgttgccgtcgtgcagggaccaaccgtcggctgtggc
gtctccctggcgctcgcttgtgacctcgtattggcctccgacaatgcgtttttcatgctc
gctcacaccaacgtggggttgatgcccgacggcggcgcgtcggcgttggttcaggccgcg
atcggccgcatccgcgccatgcatatggcgctgctgccggaccgggtgccggccgccgag
gccttgtcctggggcctggtcagcgccgtctatccggccgccgacttcgatgccgaggtg
gacaagttgatctcacggctgttggccggcccagcgctggctatcgccaagacgaagaac
gcgatcaatgcggccacgctcaccgagttggcacccactctcctgcgcgaattggatggc
caggccctcctcctgcgtactgacgacttcgccgagggcgcaacggcattccagcagcgc
cggacccccatgttcaccggccgttga

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1368Help
Entry
CCDC5079_1368     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_1368
   00650 Butanoate metabolism
    CCDC5079_1368
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_1368
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_1368
   00310 Lysine degradation
    CCDC5079_1368
   00360 Phenylalanine metabolism
    CCDC5079_1368
   00380 Tryptophan metabolism
    CCDC5079_1368
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_1368
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_1368
   00281 Geraniol degradation
    CCDC5079_1368
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_1368
   00627 Aminobenzoate degradation
    CCDC5079_1368
   00930 Caprolactam degradation
    CCDC5079_1368
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ46558
LinkDB All DBs
Position
1659102..1659905
Genome map
AA seq 267 aa AA seqDB search
MVLVEHPRPEIAQITLNRPERMNSMAFDVMVPLKEALAQVSYDNSVRVVVLTGAGRGFSP
GADHKSAGVVPHVENLTRPTYALRSMELLDDVILMLRRLHQPVIAAVNGPAIGGGLCLAL
AADIRVASSSAYFRAAGINNGLTASELGLSYLLPRAIGSSRAFEIMLTGRDVSAEEAERI
GLVSRQVPDEQLLDACYAIAARMAGFSRPGIELTKRTLWSGLDAASLEAHMQAEGLGQLF
VRLLTANFEEAVAARAEQRAPVFTDDT
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttggtcctcgtcgaacacccgcggcccgagatcgcgcagattaccctcaaccggccggag
cggatgaactccatggcattcgatgtcatggtgccgctcaaagaggccttagcgcaggtc
agctacgacaactcggtgcgggtggtggtgctgaccggcgcgggtcgagggttttctccg
ggtgcggatcacaagtcggcgggggtggtgccgcacgtcgagaacttgactcggcccacc
tacgcgctgcgttcgatggagctcctcgatgacgtcatcttaatgctgcgacggctgcac
cagccggtgatcgccgcggtcaacggccccgccatcggtggtgggctgtgcctggcactg
gctgcagacattcgggtggcctcgagtagcgcctacttccgggccgccggtatcaacaac
gggctgaccgccagcgaattggggctgagctacctgttgcccagggccattggatcctca
cgtgcgttcgagatcatgttgaccggtcgcgacgtcagcgccgaggaagccgagaggatc
gggctggtatcccgtcaggtacccgatgaacagctgctagatgcctgctacgcgatcgcc
gcacggatggcgggattctcgcggccgggaattgagttgaccaaacgtacgctgtggagt
ggactggacgccgccagtctggaggcgcacatgcaggccgagggcttggggcagctcttc
gtccggctgctcaccgccaacttcgaagaagcggttgccgcacgggccgagcagcgggcg
ccggtgttcaccgatgacacgtaa

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1789Help
Entry
CCDC5079_1789     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_1789
   00650 Butanoate metabolism
    CCDC5079_1789
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_1789
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_1789
   00310 Lysine degradation
    CCDC5079_1789
   00360 Phenylalanine metabolism
    CCDC5079_1789
   00380 Tryptophan metabolism
    CCDC5079_1789
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_1789
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_1789
   00281 Geraniol degradation
    CCDC5079_1789
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_1789
   00627 Aminobenzoate degradation
    CCDC5079_1789
   00930 Caprolactam degradation
    CCDC5079_1789
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ46979
LinkDB All DBs
Position
complement(2168613..2169569)
Genome map
AA seq 318 aa AA seqDB search
MFVGRVGPVDRRSDGERSRRPREFEYIRYETIDDGRIAAITLDRPKQRNAQTRGMLVELG
AAFELAEADDTVRVVILRAAGPAFSAGHDLGSADDIRERSPGPDQHPSYRCNGATFGGVE
SRNRQEWHYYFENTKRWRNLRKITIAQVHGAVLSAGLMLAWCCDLIVASEDTVFADVVGT
RLGMCGVEYFGHPWEFGPRKTKELLLTGDCIGADEAHALGMVSKVFPADELATSTIEFAR
RIAKVPTMAALLIKESVNQTVDAMGFSAALDGCFKIHQLNHAHWGEVTGGKLSYGTVEYG
LEDWRAAPQIRPAIKQRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcggcagggtcggtccggtcgatcgccggtcggacggggaacgctcccgacgg
ccccgggagttcgaatacatccgctacgaaaccatcgacgatgggcgcatcgccgcgatc
accctggaccgcccgaaacaacgcaacgcccagacccgcggcatgctggtcgagctgggc
gccgccttcgaacttgccgaggcggacgacaccgtccgggtggtgatcctgcgggccgcc
ggccccgccttctccgccggtcacgacctcggatccgctgacgatatccgggaacgctcg
cccgggccggaccagcaccccagctaccggtgcaacggggcgaccttcggcggggtcgag
tcacgcaaccgccaggagtggcactactacttcgaaaacaccaagcggtggcgcaacctg
cgcaagatcaccatcgcccaggtgcacggggccgtgctgtcggcggggttgatgctggcc
tggtgctgcgatctgatcgtcgccagcgaggacaccgtgttcgccgatgtggtcggcacc
cggctgggcatgtgcggggtcgagtacttcggacatccgtgggagttcgggccgcgcaag
accaaggaactgctgctcaccggcgactgcataggcgccgacgaggcccacgcgctgggg
atggtcagcaaggtgtttcccgctgacgaactcgcgaccagcacaatcgaattcgcgcgt
cggatcgcgaaggtgccgacgatggcggcactgctgatcaaggaatcggtgaaccaaacc
gtcgatgccatggggttttccgccgcgctggacggttgcttcaagatccaccagctcaat
cacgcgcactggggcgaagtcaccggcggcaagctgtcctacggaacggtcgagtacggc
ctggaggactggcgcgccgcaccgcagatccggcccgcgatcaagcagcggccctga

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_2292Help
Entry
CCDC5079_2292     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_2292
   00650 Butanoate metabolism
    CCDC5079_2292
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_2292
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_2292
   00310 Lysine degradation
    CCDC5079_2292
   00360 Phenylalanine metabolism
    CCDC5079_2292
   00380 Tryptophan metabolism
    CCDC5079_2292
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_2292
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_2292
   00281 Geraniol degradation
    CCDC5079_2292
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_2292
   00627 Aminobenzoate degradation
    CCDC5079_2292
   00930 Caprolactam degradation
    CCDC5079_2292
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_2292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ47482
LinkDB All DBs
Position
2776147..2776917
Genome map
AA seq 256 aa AA seqDB search
MAQYDPVLLSVDKHVALITVNDPDRRNAVTDEMSAQLRAAIQRAEGDPDVHAVVVTGAGK
AFCAGADLSALGAGVGDPAEPRLLRLYDGFMAVSSCNLPTIAAVNGAAVGAGLNLALAAD
VRIAGPAALFDARFQKLGLHPGGGATWMLQRAVGPQVARAALLFGMCFDAESAVRHGLAL
MVADDPVTAALELAAGPAAAPREVVLASKATMRATASPGSLDLEQHELAKRLELGPQAKS
VQSPEFAARLAAAQHR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcccaatacgacccggtcttgctcagcgtcgacaagcacgttgcgctcatcacggtc
aacgacccggaccgacggaacgccgtcaccgacgagatgtcggcgcagttgcgtgcggcg
atccaacgcgccgaaggcgaccccgacgtacacgccgtagtcgtgaccggggcgggcaag
gccttctgcgccggggccgacctgagtgcgctgggcgccggggtcggcgatccagccgag
ccgagattgttacggctctacgacggtttcatggccgtcagtagttgtaatctgcccacc
atcgccgcggtcaacggcgcggctgtgggcgccggactcaatctggcgttggccgccgat
gtgcgcatcgccggaccggccgcattgttcgacgcccgcttccaaaagctgggactgcat
ccaggtggcggcgcaacctggatgctgcagcgagcggtgggtccgcaggtcgcccgtgcg
gccttattgttcggcatgtgcttcgacgccgaatccgctgtgcggcacggcttggcgcta
atggttgccgacgatcccgtcaccgcggcgctggagctggccgccgggcccgcagccgcc
ccgcgcgaggtcgtgctggcgagcaaagccaccatgcgcgccacagccagccccggatcg
ctggaccttgagcaacacgaactcgccaaacgcttagaacttgggccgcaggcgaaatcg
gtccagtcgcccgagttcgccgctcgcttggctgccgctcaacacaggtag

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_2462Help
Entry
CCDC5079_2462     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase echA15
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_2462
   00650 Butanoate metabolism
    CCDC5079_2462
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_2462
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_2462
   00310 Lysine degradation
    CCDC5079_2462
   00360 Phenylalanine metabolism
    CCDC5079_2462
   00380 Tryptophan metabolism
    CCDC5079_2462
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_2462
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_2462
   00281 Geraniol degradation
    CCDC5079_2462
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_2462
   00627 Aminobenzoate degradation
    CCDC5079_2462
   00930 Caprolactam degradation
    CCDC5079_2462
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ47652
LinkDB All DBs
Position
2975610..2976440
Genome map
AA seq 276 aa AA seqDB search
MPVTYDDFPSLRCEIHDQPGHEGVLELVLDSPGLNSVGPHMHRDLADIWPVIDRDPAVRV
VLVRGEGKAFSSGGSFDLIAETIGDYQGRLRIMREARDLVLNLVNFDKPVVSAIRGPAVG
AGLVVALLADISVAGRAAKIIDGHTKLGVAAGDHAAICWPLLVGMAKAKYYLLTCEPLSG
EEAERIGLVSICVDDDDVLPTATRLAERLAAGAQNAIRWTKRSLNHWYRMFGPAFETSLG
LEFIGFGGPDVREGLAAHREKRPARFGADPDPGAGS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccagttacctacgacgacttccccagcctgcgctgcgaaatccacgaccaacctggt
cacgaaggcgtgctggagctggtgctggactcccccgggctgaactcggtcgggccgcac
atgcaccgcgaccttgccgacatctggccggtgatcgatcgcgacccggccgtgcgcgtg
gtcttggtccgcggtgaaggcaaggccttttcctccggcggcagtttcgacctgatcgcc
gaaaccatcggcgactaccagggccggctgcgcatcatgcgcgaggcccgcgacctggtg
ctcaacctggtcaacttcgacaagccggtggtgtcggcgattcggggcccggccgtcggt
gcgggtctggttgtcgcgctgctcgccgacatttcggtggcgggccgcgccgcgaagatc
atcgatgggcacaccaaactcggggtcgccgcgggggatcacgcggcgatctgctggccc
ctgctggtcggcatggccaaggccaagtactacctgctgacctgcgagccgctgtccggg
gaggaggccgaacgcatcggtctggtctccatctgcgtcgacgacgacgatgtgctcccc
accgcaacacgcctggcggagcggctcgccgctggcgcgcaaaacgccatccgctggacc
aaacgcagcctcaatcactggtatcgcatgttcggtcccgccttcgaaacgtcgctcggg
ctggagttcatcgggttcggtggtcccgacgtccgggaaggcctggccgcgcaccgcgaa
aagcgccccgcgcggttcggcgccgaccccgatcccggcgccggcagctga

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_2592Help
Entry
CCDC5079_2592     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_2592
   00650 Butanoate metabolism
    CCDC5079_2592
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_2592
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_2592
   00310 Lysine degradation
    CCDC5079_2592
   00360 Phenylalanine metabolism
    CCDC5079_2592
   00380 Tryptophan metabolism
    CCDC5079_2592
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_2592
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_2592
   00281 Geraniol degradation
    CCDC5079_2592
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_2592
   00627 Aminobenzoate degradation
    CCDC5079_2592
   00930 Caprolactam degradation
    CCDC5079_2592
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_2592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 AMMECR1
Motif
Other DBs
NCBI-ProteinID: AEJ47782
LinkDB All DBs
Structure
PDB: 

Position
3111713..3112462
Genome map
AA seq 249 aa AA seqDB search
MTDDILLIDTDERVRTLTLNRPQSRNALSAALRDRFFAALADAEADDDIDVVILTGADPV
FCAGLDLKELAGQTALPDISPRWPAMTKPVIGAINGAAVTGGLELALYCDILIASEHARF
ADTHARVGLLPTWGLSVRLPQKVGIGLARRMSLTGYYLSATDALRAGLVTEVVAHDQLLP
TARRVAASIVGNNQNAVRALLASYHRIDESQTAAGLWLEACAAKQFRTSGDTIAANREAV
LQRGRAQVR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacatcctgctgatcgacaccgacgaacgggtgcgaaccctcaccctcaac
cggccgcagtcccgcaacgcgctctcggcggcgctacgggatcggtttttcgcggcgttg
gccgacgccgaggccgacgacgacatcgacgtcgtcatcctcaccggcgccgatccggtg
ttctgcgccggactggacctcaaggagctggccgggcagaccgcgctgccggacatctca
ccgcggtggccggccatgaccaagccggtgatcggcgcgatcaacggcgccgcggtcacc
ggcgggctcgaactggcgctgtactgcgacatcctgatcgcctccgagcacgcccgcttc
gccgacacccacgcccgggtgggcctgctgcccacctggggactcagcgtgcgcttgccg
caaaaggtcggcatcggcctggcccggcggatgagcctgaccggctactacctgtccgcg
accgacgcgttgcgggccggcctggtcaccgaggtggtggcccacgaccagctgctgccc
accgcccgccgggtggcggcgtcgatcgtcggcaacaaccagaacgcggtgcgggcattg
ctggcgtcctaccaccgcatcgacgagtctcagaccgccgccgggctgtggctggaagcc
tgcgcggccaagcaatttcgcactagcggcgataccatcgccgccaaccgcgaagccgtg
ctgcagcgcggccgcgcgcaggtgcgttag

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_2796Help
Entry
CCDC5079_2796     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_2796
   00650 Butanoate metabolism
    CCDC5079_2796
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_2796
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_2796
   00310 Lysine degradation
    CCDC5079_2796
   00360 Phenylalanine metabolism
    CCDC5079_2796
   00380 Tryptophan metabolism
    CCDC5079_2796
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_2796
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_2796
   00281 Geraniol degradation
    CCDC5079_2796
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_2796
   00627 Aminobenzoate degradation
    CCDC5079_2796
   00930 Caprolactam degradation
    CCDC5079_2796
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_2796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ47986
LinkDB All DBs
Position
complement(3375367..3376152)
Genome map
AA seq 261 aa AA seqDB search
MAAVTPTVPEFVNVVVSDGSQDAGLAMLLLSRPPTNAMTRQVYREVVAAANELGRRDDVA
AVILYGGHEIFSAGDDMPELRTLSAQEADTAARIRQQAVDAVAAIPKPTVAAITGYALGA
GLTLALAADWRVSGDNVKFGATEILAGLIPSGDGMARLTRAAGPSRAKELVFSGRFFDAE
EALALGLIDDMVAPDDVYDAAAAWARRFLDGPPHALAAAKAGISDVYELAPAERIAAERR
RYVEVFAAGQGGGSKGDRGGR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggccgctgtgacgccaacggtgcccgagttcgtcaacgtcgtggtcagtgacggctcc
caggatgccggcctggccatgttgctcctatcgcgaccgcctaccaacgcgatgacccgc
caggtctaccgggaagtggtcgccgcggccaacgagctggggcgacgcgacgacgtggcc
gcagtgatcctgtatggcggccacgaaatcttctccgccggcgacgacatgcccgaactg
cggacattgagcgcgcaggaggccgacaccgccgcccggattcggcagcaggccgtcgac
gccgttgcggcgatccccaagccgaccgtggccgccatcaccggatacgcgttgggtgcc
ggccttacgctggccctagccgccgattggcgagtcagcggtgacaacgtgaaattcggc
gcgaccgagatcctggccggcctgatccccagcggcgacggaatggcccggctgacccgt
gcggccggtccgagcagagccaaggagctggtgttcagcgggcgcttcttcgacgccgag
gaggccttggcgctgggcctgatcgacgacatggtggcccccgacgacgtttacgacgcc
gcggcggcctgggcgaggcgctttcttgacggcccgccgcacgcgctggccgcggccaaa
gccgggatcagcgacgtctacgagctggcgccggccgagcggatcgccgctgagcgtcgg
cgctatgtcgaggtgttcgccgctggtcaaggtggtggcagcaagggtgaccggggcggc
cgttag

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_3121Help
Entry
CCDC5079_3121     CDS       T01991                                 

Definition
(GenBank) putative enoyl-CoA hydratase echA18
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_3121
   00650 Butanoate metabolism
    CCDC5079_3121
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_3121
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_3121
   00310 Lysine degradation
    CCDC5079_3121
   00360 Phenylalanine metabolism
    CCDC5079_3121
   00380 Tryptophan metabolism
    CCDC5079_3121
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_3121
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_3121
   00281 Geraniol degradation
    CCDC5079_3121
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_3121
   00627 Aminobenzoate degradation
    CCDC5079_3121
   00930 Caprolactam degradation
    CCDC5079_3121
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_3121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ48310
LinkDB All DBs
Position
3771723..3772349
Genome map
AA seq 208 aa AA seqDB search
MTKMDEASNPCGGDIEAEMCQLMREQPPAEGVVDRVALQRHRNVALITLSHPQAQNALNL
ASWRRLKRLLDDLAGESGLRAVVLRGAGDKAFAAGADIKEFPNTRMSAADAAEYNESLAV
CLRALTTMPIPVIAAVRGLAVGGGCELATACDVCIATDDARFGIPLGKLGVTTGFTEADT
VARLIGPAALKYLLFSGELIGIEEAARW
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagatggacgaggctagcaatccgtgcggcggggacatcgaagctgagatgtgc
cagttgatgcgcgagcaaccacccgccgaaggcgtcgtcgatcgtgtcgcgctgcaacgc
catcgaaacgttgcgttgatcacgctgagccatccgcaggcgcagaacgcactcaacctg
gcgagctggcgtcggctgaagcggctgctggacgatctcgccggcgaatcggggctgcgg
gcggtggtgctgcggggcgccggtgacaaggcgttcgccgcgggtgccgacatcaaggag
tttccgaacacccgcatgagcgccgcggacgccgcggagtacaacgagagcctggccgtc
tgcctgagggcgttgaccacgatgccgatcccagtcatcgcggcggtccgggggctcgcc
gtcggtggcggctgtgagctggcgacggcctgcgatgtgtgcatcgcgaccgacgacgcg
cgcttcggcatcccgctgggcaagctcggcgtcacgacgggcttcaccgaggcggacacc
gtcgcgcgcctcatcggtccggcggcgctgaagtatctgttgttcagcggagaactgatc
ggcattgaggaagccgcccgctggtga

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_3257Help
Entry
CCDC5079_3257     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase echA19
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_3257
   00650 Butanoate metabolism
    CCDC5079_3257
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_3257
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_3257
   00310 Lysine degradation
    CCDC5079_3257
   00360 Phenylalanine metabolism
    CCDC5079_3257
   00380 Tryptophan metabolism
    CCDC5079_3257
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_3257
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_3257
   00281 Geraniol degradation
    CCDC5079_3257
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_3257
   00627 Aminobenzoate degradation
    CCDC5079_3257
   00930 Caprolactam degradation
    CCDC5079_3257
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_3257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ48446
LinkDB All DBs
Position
3939228..3940037
Genome map
AA seq 269 aa AA seqDB search
MAAVATVESGPDALVERRGHTLIVTMNRPAARNALSTEMMRIMVQAWDRVDNDPDIRCCI
LTGAGGYFCAGMDLKAATQKPPGDSFKDGSYDPSRIDALLKGRRLTKPLIAAVEGPAIAG
GTEILQGTDIRVAGESAKFGISEAKWSLYPMGGSAVRLVRQIPYTLACDLLLTGRHITAA
EAKEMGLIGHVVPDGQALTKALELADAISANGPLAVQAILRSIRETECMPENEAFKIDTQ
IGIKVFLSDDAKEGPRAFAEKRAPNFQNR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtggcggccgtggcaaccgtggaatccggacccgacgcgctggtggagcggcgcggccac
accctgatcgtgaccatgaaccggccggccgcccgcaacgcgctgagcaccgaaatgatg
cgaatcatggtgcaggcctgggatcgcgtcgacaacgatcccgacatccgttgctgcatc
ctcaccggagccggtggctacttttgcgccggcatggacctcaaggcggcaacccagaaa
ccgccgggcgactctttcaaggacggcagctacgacccgtcgcgcatcgatgccctgctc
aaagggcgccgcttgaccaaaccgctgatcgccgccgtcgaggggcccgcgatcgccggc
ggcaccgagatcctgcagggcaccgacatccgggtcgccggtgaaagtgcgaagttcggc
atctccgaggccaagtggagcctgtacccgatgggcggctcggccgtgcggctggtccgg
cagatcccctacactctggcctgcgacctgctgctgaccggacggcacattaccgccgcc
gaggccaaggaaatgggcctgatcggccacgtggtgcccgacggccaggcgctgaccaag
gctctagaacttgccgacgccatctcggctaacggacccctggccgtgcaggccatcctg
cggtccatccgcgagaccgagtgcatgcccgaaaacgaggcgttcaagatcgacacccag
atcggcatcaaggtcttcctgtccgacgacgccaaggaaggcccgcgcgcgttcgccgag
aagcgcgcacccaacttccagaaccgctag

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_3291Help
Entry
CCDC5079_3291     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_3291
   00650 Butanoate metabolism
    CCDC5079_3291
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_3291
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_3291
   00310 Lysine degradation
    CCDC5079_3291
   00360 Phenylalanine metabolism
    CCDC5079_3291
   00380 Tryptophan metabolism
    CCDC5079_3291
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_3291
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_3291
   00281 Geraniol degradation
    CCDC5079_3291
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_3291
   00627 Aminobenzoate degradation
    CCDC5079_3291
   00930 Caprolactam degradation
    CCDC5079_3291
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_3291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ48480
LinkDB All DBs
Position
3975854..3976597
Genome map
AA seq 247 aa AA seqDB search
MPITSTTPEPGIVAVTVDYPPVNAIPSKAWFDLADAVTAAGANSDTRAVILRAEGRGFNA
GVDIKEMQRTEGFTALIDANRGCFAAFRAVYECAVPVIAAVNGFCVGGGIGLVGNSDVIV
ASEDATFGLPEVERGALGAATHLSRLVPQHLMRRLFFTAATVDAATLQHFGSVHEVVSRD
QLDEAALRVARDIAAKDTRVIRAAKEALNFIDVQRVNASYRMEQGFTFELNLAGVADEHR
DAFVKKS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcacctccaccacgcccgaaccgggcatcgtcgcggtcaccgtcgactacccg
ccggtcaacgccatcccgtcgaaagcgtggttcgacctggccgacgcggtgacggccgcg
ggcgccaactccgacacccgcgcggtgatcctgcgggccgaggggcgcggcttcaacgcc
ggggtggacatcaaagagatgcaacgaaccgaaggtttcacggcgctgatcgacgccaac
cgcggctgcttcgccgcattccgcgccgtctacgagtgcgcggtgccggtgatcgccgcc
gtgaacggattctgcgtgggcggcggcatcggcctggtcggcaactccgacgtcatcgtg
gcctccgaggacgccaccttcggcctgcccgaggtggaacggggcgcgctgggcgcggcc
acgcacctctcgcggctggtgccccagcacctgatgcgacggctgttctttacggcggcc
accgtggacgcggccaccttgcagcacttcggctcggtgcacgaggtggtgtcccgcgat
cagctggacgaggccgctttgcgggtggcccgcgacatcgccgccaaagacacccgggtc
atccgcgccgccaaggaggcgctgaacttcatcgacgtgcaacgggtcaatgcgagttac
cggatggagcaaggttttaccttcgagctcaacctcgccggagtcgccgacgagcaccgc
gacgcctttgtgaagaagtcatag

KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_3502Help
Entry
CCDC5079_3502     CDS       T01991                                 

Definition
(GenBank) enoyl-CoA hydratase echA21
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00281  Geraniol degradation
mte00310  Lysine degradation
mte00360  Phenylalanine metabolism
mte00362  Benzoate degradation
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00627  Aminobenzoate degradation
mte00640  Propanoate metabolism
mte00650  Butanoate metabolism
mte00903  Limonene and pinene degradation
mte00930  Caprolactam degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01212  Fatty acid metabolism
Module
mte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCDC5079_3502
   00650 Butanoate metabolism
    CCDC5079_3502
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_3502
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_3502
   00310 Lysine degradation
    CCDC5079_3502
   00360 Phenylalanine metabolism
    CCDC5079_3502
   00380 Tryptophan metabolism
    CCDC5079_3502
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_3502
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_3502
   00281 Geraniol degradation
    CCDC5079_3502
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCDC5079_3502
   00627 Aminobenzoate degradation
    CCDC5079_3502
   00930 Caprolactam degradation
    CCDC5079_3502
Enzymes [BR:mte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCDC5079_3502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ48691
LinkDB All DBs
Position
4206058..4206942
Genome map
AA seq 294 aa AA seqDB search
MGNLVRVAIQAAYWPRYGLGMGETYESVTVETKDQVAQVTLIGPGKGNAMGPAFWSEMPE
VFHALDADREVRAIVITGSGKNFSYGLDVPAMGGMFAPLIADGALARPRTDFHTEILRMQ
KAINAVADCRTPTIAAVQGWCIGGAVDLISAVDIRYASADAKFSVREVKLAIVADMGSLA
RLPLILSDGHLRELALTGKNIDAARAEKIGLVNDVYDDADQTLAAAHATAAEIAANPPLA
VYGIKDVLDQQRTSAVSENLRYVAAWNAAFLPSKDLTEGISATFAKRPPQFTGE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtggggaatctggtccgggtcgcgattcaggcggcatactggccacgctacggtctgggc
atgggcgaaacctacgaatccgtcaccgtcgaaaccaaggaccaggtcgcgcaggtgacg
ctgatcgggccgggcaagggcaacgcgatgggacccgcattctggtcggagatgcccgag
gtgttccatgccctggacgccgaccgtgaggtgcgggccatcgtcatcaccggatcgggc
aagaacttcagctacggcctggacgtaccggccatgggcggaatgttcgccccgttgatc
gccgacggcgcgctggcccgcccacgcacggacttccacaccgaaatactgcgcatgcag
aaggcgatcaacgccgtcgccgactgccgcacccccacgatcgcggccgtccagggttgg
tgcatcggcggcgccgtcgacctgatctccgcggtcgacatccggtatgccagcgccgac
gcgaagttctcggtgcgcgaggtcaagctagcgattgttgccgacatgggcagcctggcg
cgccttccactaatcctgagcgacggccatctacgagaactcgcgctgaccggcaaaaat
atcgacgcggcccgcgccgagaagatcggcctggtcaacgacgtctacgatgacgccgac
cagacgctggccgcggcccacgcgactgccgccgagatcgccgccaacccacctttggcg
gtctacggcatcaaggacgttctcgaccaacaacgcacgtccgccgtctcggagaacctg
cgctatgtcgccgcctggaacgccgcgtttctgccgtccaaggacctcaccgaaggtatt
tccgcgacgttcgccaagcgcccgccccagttcaccggcgagtag

DBGET integrated database retrieval system