KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_0208Help
Entry
CCDC5079_0208     CDS       T01991                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00010  Glycolysis / Gluconeogenesis
mte00053  Ascorbate and aldarate metabolism
mte00071  Fatty acid degradation
mte00280  Valine, leucine and isoleucine degradation
mte00310  Lysine degradation
mte00330  Arginine and proline metabolism
mte00340  Histidine metabolism
mte00380  Tryptophan metabolism
mte00410  beta-Alanine metabolism
mte00561  Glycerolipid metabolism
mte00620  Pyruvate metabolism
mte00625  Chloroalkane and chloroalkene degradation
mte00903  Limonene and pinene degradation
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCDC5079_0208
   00053 Ascorbate and aldarate metabolism
    CCDC5079_0208
   00620 Pyruvate metabolism
    CCDC5079_0208
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCDC5079_0208
   00561 Glycerolipid metabolism
    CCDC5079_0208
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCDC5079_0208
   00310 Lysine degradation
    CCDC5079_0208
   00330 Arginine and proline metabolism
    CCDC5079_0208
   00340 Histidine metabolism
    CCDC5079_0208
   00380 Tryptophan metabolism
    CCDC5079_0208
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCDC5079_0208
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCDC5079_0208
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CCDC5079_0208
Enzymes [BR:mte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CCDC5079_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AEJ45398
LinkDB All DBs
Structure
PDB: 

Position
complement(263931..265394)
Genome map
AA seq 487 aa AA seqDB search
MSDSGTEYDKLFIGGKWTKPSTSDVIEVRCPATGEYVGKVPMAAAADVDAAVAAARAAFD
NGPWPSTPPHERAAVIAAAVKMLAERKDLFTKLLAAETGQPPTIIETMHWMGSMGAMNYF
AGAADKVTWTETRTGSYGQSIVSREPVGVVGAIVAWNVPLFLAVNKIAPALLAGCTIVLK
PAAETPLTANALAEVFAEVGLPEGVLSVVPGGIETGQALTSNPDIDMFTFTGSSAVGREV
GRRAAEMLKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGVMNAGQGCVNQTRILAPRSR
YDEIVAAVTNFVTALPVGPPSDPAAQIGPLISEKQRTRVEGYIAKGIEEGARLVCGGGRP
EGLDNGFFIQPTVFADVDNKMTIAQEEIFGPVLAIIPYDTEEDAIAIANDSVYGLAGSVW
TTDVPKGIKISQQIRTGTYGINWYAFDPGSPFGGYKNSGIGRENGPEGVEHFTQQKSVLL
PMGYTVA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacagtggcacggaatacgacaagcttttcatcggcggcaagtggaccaaaccg
tcgacctccgatgttatcgaggtacgctgcccagccactggggaatatgtcggcaaggtg
ccgatggcggccgccgccgacgtcgacgccgcggtcgccgcagcacgtgcggcgttcgac
aacggcccctggccctcgaccccgccgcacgagcgtgcggcggtgatcgctgcggcggtc
aagatgctggctgagcgcaaggacctgttcaccaagctgctcgcagccgaaaccggccag
ccgccgaccatcatcgagacgatgcactggatgggttcgatgggggcgatgaactacttt
gccggtgcagcggacaaggtcacctggaccgaaacccgcaccggctcctatggacagagc
attgtcagccgtgagccggtcggtgtggtgggcgcgatcgtggcctggaacgtcccgctg
tttctggccgtcaacaagattgcgccggcgctgctggccggctgcaccatcgtgctcaag
cccgccgccgaaacaccgctgaccgcaaacgctttggcggaggtgttcgccgaggtgggc
ctgcccgagggggtgttgtcggtagtgccgggagggattgagaccggtcaggcgctgacg
tctaacccggacatcgacatgtttaccttcaccggcagctcggccgtcggccgagaggtc
ggcaggcgtgccgctgagatgctcaagccgtgcaccttagaactcggcggcaagtcggcg
gccatcattctcgaggacgtcgacctggccgcagctattccgatgatggtgttctccggc
gtcatgaacgccggacagggctgcgtcaaccagacccgcattctggctccgcgctcccgg
tacgacgaaatcgtggctgcggtaactaatttcgtaacggctctcccggtgggcccgccg
tcggacccggcagctcagatcgggccgctgatctcggagaagcagcggactcgcgttgaa
ggctacatcgccaagggcatcgaggagggcgctcggttggtgtgcggcggcggccgtccc
gagggcttggacaacggcttctttatccaacccaccgtattcgccgatgtcgacaacaag
atgaccatcgcacaggaggagatcttcgggccggtgctggccatcattccttatgacacc
gaggaggacgcgatcgcgatcgccaacgattcagtgtatgggctggcgggcagcgtgtgg
accaccgacgtgcccaaaggcatcaagatctcgcagcagatccgcaccgggacatacgga
atcaactggtacgccttcgatcccggctcacccttcggcggctacaagaactccggaatc
ggccgcgagaacgggcccgagggtgtcgaacacttcacccagcaaaagagtgtcctgctg
ccgatgggctacaccgtcgcgtag

DBGET integrated database retrieval system