KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1016Help
Entry
CCDC5079_1016     CDS       T01991                                 

Definition
(GenBank) hypothetical protein
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00010  Glycolysis / Gluconeogenesis
mte00030  Pentose phosphate pathway
mte00051  Fructose and mannose metabolism
mte00680  Methane metabolism
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01200  Carbon metabolism
Module
mte_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCDC5079_1016
   00030 Pentose phosphate pathway
    CCDC5079_1016
   00051 Fructose and mannose metabolism
    CCDC5079_1016
  09102 Energy metabolism
   00680 Methane metabolism
    CCDC5079_1016
Enzymes [BR:mte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CCDC5079_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AEJ46206
LinkDB All DBs
Structure
PDB: 

Position
complement(1223824..1224876)
Genome map
AA seq 350 aa AA seqDB search
MASHDPSHTRPSRREAPDRNLAMELVRVTEAGAMAAGRWVGRGDKEGGDGAAVDAMRELV
NSVSMRGVVVIGEGEKDHAPMLYNGEEVGNGDGPECDFAVDPIDGTTLMSKGMTNAISVL
AVADRGTMFDPSAVFYMNKIAVGPDAAHVLDITAPISENIRAVAKVKDLSVRDMTVCILD
RPRHAQLIHDVRATGARIRLITDGDVAGAISACRPHSGTDLLAGIGGTPEGIIAAAAIRC
MGGAIQAQLAPRDDAERRKALEAGYDLNQVLTTEDLVSGENVFFCATGVTDGDLLKGVRY
YPGGCTTHSIVMRSKSGTVRMIEAYHRLSKLNEYSAIDFTGDSSAVYPLP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtggccagccacgacccgtcgcacaccaggccatcgcgccgggaagccccggaccgcaac
ctggccatggagctggtccgggtgaccgaggccggagccatggccgcgggccgctgggta
ggccgcggcgacaaggagggcggcgacggcgcggcggtcgacgcgatgcgcgaactggtc
aactcggtttccatgcgcggggtggtggtcatcggcgaaggcgaaaaggaccacgcacca
atgctctacaacggcgaagaagtgggcaacggcgacggaccggaatgcgactttgccgtc
gaccccattgacggcaccacgctgatgagcaagggcatgaccaacgccatctcggtgctg
gcggtagccgatcgcggcaccatgttcgacccgtcggcggtgttctacatgaacaaaatc
gccgtcggccccgatgccgcacacgtgctggatatcaccgcgccgatctcggaaaacatc
cgagcggtcgccaaggtcaaggacctgtcggtgcgagacatgacggtgtgcatcctggac
aggccgcggcacgcgcaactcatccacgacgtccgcgccaccggggcccggatccggctg
atcaccgatggcgacgtcgccggcgcgatctcggcgtgccgaccgcactccggcaccgac
ctgctagctgggatcggcggcaccccggagggaatcatcgccgccgcggcgatccgctgc
atgggcggggcgatccaggcgcagctcgccccgcgcgacgacgcggaacgccgcaaggcc
ctagaagccggttacgacctgaaccaggtcttgaccacagaagatctggtgtccggggaa
aacgtcttcttctgcgccactggggtcaccgacggcgacctgctcaagggagtgcgttac
taccccggcggctgcaccacccattcgatcgtgatgcgctcgaagtccggcaccgtccgg
atgatcgaggcctaccaccggctttcaaagctcaacgaatactccgcgatcgacttcacc
ggcgacagcagcgccgtgtacccattgccctaa

DBGET integrated database retrieval system