KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_1333Help
Entry
CCDC5079_1333     CDS       T01991                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00010  Glycolysis / Gluconeogenesis
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01200  Carbon metabolism
mte01230  Biosynthesis of amino acids
Module
mte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mte_M00002  Glycolysis, core module involving three-carbon compounds
mte_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCDC5079_1333
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mte04131]
    CCDC5079_1333
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mte04147]
    CCDC5079_1333
Enzymes [BR:mte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     CCDC5079_1333
Membrane trafficking [BR:mte04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CCDC5079_1333
Exosome [BR:mte04147]
 Exosomal proteins
  Proteins found in most exosomes
   CCDC5079_1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEJ46523
LinkDB All DBs
Position
1612549..1613568
Genome map
AA seq 339 aa AA seqDB search
MTVRVGINGFGRIGRNFYRALLAQQEQGTADVEVVAANDITDNSTLAHLLKFDSILGRLP
CDVGLEGDDTIVVGRAKIKALAVREGPAALPWGDLGVDVVVESTGLFTNAAKAKGHLDAG
AKKVIISAPATDEDITIVLGVNDDKYDGSQNIISNASCTTNCLAPLAKVLDDEFGIVKGL
MTTIHAYTQDQNLQDGPHKDLRRARAAALNIVPTSTGAAKAIGLVMPQLKGKLDGYALRV
PIPTGSVTDLTVDLSTRASVDEINAAFKAAAEGRLKGILKYYDAPIVSSDIVTDPHSSIF
DSGLTKVIDDQAKVVSWYDNEWGYSNRLVDLVTLVGKSL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtccgagtaggcatcaacgggtttggtcgaatcggacgcaacttctaccgggcc
ttactggcccaacaggagcagggcaccgccgacgtggaggtggtcgccgccaacgacatc
accgacaacagcacgctggcgcatctgctcaaattcgactcgattctgggccggctgcct
tgcgatgtcggcctcgaaggcgacgacaccatcgtcgtcggccgcgcgaaaatcaaggcg
ctcgcggtccgggaggggccggcggcattgccatggggagacctcggcgtcgacgtcgtc
gtcgaatccaccggcctgttcaccaatgcggccaaagccaaaggccacctggacgccggc
gccaagaaggtgatcatctctgcgcccgccaccgacgaggacatcaccatcgtcctggga
gttaacgacgacaagtatgacggcagccagaacatcatctccaatgcgtcgtgcaccacg
aactgccttgcgccgctggccaaagtgctcgacgatgagttcggcatcgtcaagggcctg
atgaccaccatccacgcctacactcaggatcagaacctgcaggacgggccgcacaaggac
ctgcgtcgcgcccgcgccgccgcgctgaacatcgtgccgacctccaccggcgcggccaag
gccatcggcctggtgatgccgcagctaaagggcaagctcgacggttatgcgctgcgggtg
ccgatccccaccggctcggtcaccgaccttacggtcgacttatccacacgggccagtgtc
gatgagatcaacgcggcgttcaaagccgcggccgaaggcaggctcaagggcattctgaag
tactacgacgcgccgatcgtctcgagcgacatcgtcaccgacccgcacagttcgattttc
gactctgggttgaccaaagtcatcgacgaccaggccaaggtggtgtcgtggtacgacaac
gagtggggctactccaaccgcctggttgatctggtcacgctggtcggcaagtcgctctag

DBGET integrated database retrieval system