KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_3576Help
Entry
CCDC5079_3576     CDS       T01991                                 

Definition
(GenBank) sodA, superoxide dismutase [Fe] SodA
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Brite
Enzymes [BR:mte01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CCDC5079_3576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEJ48765
LinkDB All DBs
Structure
PDB: 

Position
4307889..4308512
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAIL
LNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTV
QGSGWAALGWDTLGNKLLIFQVYDHQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKA
FWNVVNWADVQSRYAAATSQTKGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaatacaccttgccagacctggactgggactacggagcactggaaccgcacatc
tcgggtcagatcaacgagcttcaccacagcaagcaccacgccacctacgtaaagggcgcc
aatgacgccgtcgccaaactcgaagaggcgcgcgccaaggaagatcactcagcgatcttg
ctgaacgaaaagaatctagctttcaacctcgccggccacgtcaatcacaccatctggtgg
aagaacctgtcgcctaacggtggtgacaagcccaccggcgaactcgccgcagccatcgcc
gacgcgttcggttcgttcgacaagttccgtgcgcagttccacgcggccgctaccaccgtg
caggggtcgggctgggcggcactgggctgggacacactcggcaacaagctgctgatattc
caggtttacgaccaccagacgaacttcccgctaggcattgttccgctgctgctgctcgac
atgtgggaacacgccttctacctgcagtacaagaacgtcaaagtcgactttgccaaggcg
ttttggaacgtcgtgaactgggccgatgtgcagtcacggtatgcggccgcgacctcgcag
accaaggggttgatattcggctga

DBGET integrated database retrieval system