KEGG   Micromonospora terminaliae: GCE86_18810
Entry
GCE86_18810       CDS       T06293                                 

Definition
(GenBank) isoprenyl transferase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
mtem  Micromonospora terminaliae
Pathway
mtem00900  Terpenoid backbone biosynthesis
mtem01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtem00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GCE86_18810
Enzymes [BR:mtem01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     GCE86_18810
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: QGL51476
UniProt: A0A6I5UKB5
LinkDB
Position
complement(4135297..4136097)
AA seq 266 aa
MRAGRREPLPPTPHPSGARPPALPADALPKHVAVVMDGNGRWAKERGLPRTKGHEQGEHS
LFDTIEGAIELGIPYLSAYAFSTENWRRSPDEVRFLMGFNRDVIRRRRDQLVDLGVRVVW
SGRAGRLWKSVISELQTAEEMSRGNSTLTLQFCVNYGGQAEIADAAAAIARDAAAGRIDP
GKVTEKTIAKYLYHPEVPEVDLFLRPSGEQRTSNFLLWQTAYAELVFLDTLWPDFDRRHL
WYACELYAQRDRRFGGALPNPVAPTT
NT seq 801 nt   +upstreamnt  +downstreamnt
atgagggccggccggcgcgagccgctgccaccgactccgcacccctccggcgcccggccg
ccggcgctgccggccgacgcgctgccgaagcacgtcgccgtggtgatggacggcaacggc
cgctgggccaaggagcgcgggctgccccggaccaagggtcacgagcagggcgagcacagc
ctcttcgacaccatcgagggcgccatcgagctgggcatcccctacctgtcggcgtacgcc
ttctccaccgagaactggcggcgctcgccggacgaggtccgcttcctcatgggcttcaac
cgggacgtcatccggcgccgccgggaccagctcgtcgacctgggcgtccgggtggtctgg
tccggccgggccgggcggctctggaagagcgtcatctccgagctgcagaccgccgaggag
atgtcccgcggcaactcgacgctgaccctccagttctgcgtcaactacggcgggcaggcg
gagatcgccgacgccgccgccgcgatcgcccgcgacgcggccgccggccggatcgacccg
ggcaaggtcaccgagaagaccatcgcgaagtacctctaccacccggaggtccccgaggtg
gacctcttcctgcgcccgtccggggagcagcgcacctccaacttcctgctctggcagacc
gcctacgcggaactggtcttcctcgacacgctctggccggacttcgaccgccggcacctc
tggtacgcctgcgagctctacgcccagcgggaccgccgcttcggcggggcgctgcccaat
ccggtggcccccaccacctga

DBGET integrated database retrieval system