KEGG   Mycolicibacter terrae: 4434518_00017Help
Entry
4434518_00017     CDS       T05465                                 

Gene name
pknA
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mter  Mycolicibacter terrae
Brite
KEGG Orthology (KO) [BR:mter00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mter01001]
    4434518_00017 (pknA)
Enzymes [BR:mter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4434518_00017 (pknA)
Protein kinases [BR:mter01001]
 Serine/threonine kinases: Other
  Bacterial family
   4434518_00017 (pknA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Pkinase_fungal ABC1 DUF3999 RIO1 Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: SNV52822
UniProt: A0A1X2ED93
LinkDB All DBs
Position
1:complement(16292..17521)
Genome map
AA seq 409 aa AA seqDB search
MSPQVGAALAGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKPEFSSDPEFIERFRA
EARNTAMLNHPGIASVHDYGETELDGEGRTAFLVMELVNGEPLNSVLKRTGRLSLRHALD
MLEQTGRALQVAHSTGLVHRDVKPGNIMITPTGQVKITDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGQDATAASDVYSLGVVGYEVLCGRRPFTGDGALTVAMKHIKEPPPPLPAE
LPPNVRELIEITLAKNPGMRYRSGGPFADAVAAVRSGRRPLRPSQSLPAGRAAPSAIPST
AATRIAPPVSARATAARRARTGTGNHRPPAPRRTFTAGQRALLWAAGVLGTLAIIIAVLI
VVNAKSPGGSLAPATVTDTGGPVESSTSESQPAGPPAHSSGWTWTREAR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctcaggtcggagcggcgctggccggccgctaccggttgcagcggctcatcgcc
accggcggcatgggccaggtgtgggaggccgtcgacaaccggctgggacgtcgggtcgcg
gtcaaggtgctcaagccggagttctcctccgacccggagttcatcgaacggttccgcgcc
gaggcccgcaacaccgccatgctcaaccacccgggcatcgccagcgtgcacgactacggc
gagaccgagctggacggcgagggccgcaccgcgttcctggtgatggagctggtcaacggc
gagccgctgaactcggtgctcaaacggaccgggcgcctgtcgctgcggcacgccctggac
atgctcgagcagaccggccgggcgttgcaggtggcacacagcaccgggctggtgcaccgc
gacgtcaaaccgggcaacatcatgatcacgcccaccggtcaggtgaagatcaccgacttc
ggtatcgccaaggccgtcgacgccgcgccggtcacccagaccggaatggtgatgggcacc
gcccagtacatcgcccccgaacaggcactcgggcaggacgccaccgcggccagcgatgtg
tactcgctgggtgtcgtcgggtacgaagtcctgtgcgggcggcgcccgttcaccggtgac
ggcgcgctgaccgtcgccatgaagcacatcaaggagccgcccccgccgctgccggccgaa
ctgccgcccaacgtgcgggaactcatcgagatcacgctggccaagaaccccggcatgcgc
taccgcagcggcggccccttcgccgacgcggtcgccgcggtgcgctccggtcgccggccg
ctgcggcccagccaatcgctaccggccggccgtgccgcgccgtcggcgatcccgtcgacg
gccgcgacccggatcgcgccaccggtgtccgcccgggccaccgcggcacgacgggcccgg
accggcaccggcaaccaccgcccgccagcaccgcggcgcaccttcaccgccgggcagcgc
gcgctgctgtgggcggccggggtgctgggcacgctggcgatcatcatcgcggtgctgatc
gtggtcaacgccaagagcccgggcggctcgctggcgccggccaccgtcaccgacaccggt
gggccggtcgagtcgtcgacctcggagtcacagcccgcggggccgcccgcgcactcctcc
ggctggacctggacccgggaagcgcgatga

DBGET integrated database retrieval system