KEGG   Mycolicibacter terrae: 4434518_00842Help
Entry
4434518_00842     CDS       T05465                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mter  Mycolicibacter terrae
Pathway
mter03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mter00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    4434518_00842
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mter03400]
    4434518_00842
Enzymes [BR:mter01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     4434518_00842
DNA repair and recombination proteins [BR:mter03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     4434518_00842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: SNV59862
UniProt: A0A1X2DKH4
LinkDB All DBs
Position
1:889235..891520
Genome map
AA seq 761 aa AA seqDB search
MSAEPFKTRVKLTNADKVLYPATGTTKADVFDYYTRIAEVMLPHIAGRPATRKRWPNGVE
QDSFFEKQLASSAPSWLRRAAVQHRSGTTTYPIIDDPDGLAWIAQQAALEVHVPQWRFEA
EWTRGGEVIKPGRSTRLVFDLDPGEGVTMSQLAEVARAIRDLMAELDLEVFPLTSGSKGV
HLYAPLDRPVASDGAVAVAKRVAQQLESAMPKLVTATMAKKLRAGKVFLDWSQNNAAKTT
IAPYSLRGREHPTVAAPRTWAELDDPKLRQLRYDEVLARVARDGDLLAGLDPPLSKPDRL
SHYRAKRDAAKTPEPVPAAAPAPGGGNSYFVIQEHHARRLHYDFRLERDGVLVSWAVPKN
LPDAPSVNHLAVRTEDHPLEYGSFEGTIPKGEYGAGTVRIWDSGSYVTEKFEDSAEKGEV
IVVLRGSRISGRYALIRTGGDQWLAHRMKDQKTFALADLAPMLATHGSVTRLDPDTWAFE
GKWDGYRLLVDADRGRVRLRSRSGRDVTGEYPQLRSLAADLAEHHLVLDGEVVALDSASV
PSFAAMQNSARSTRVEFWAFDLLYLDGRPLLRAAYRDRRRLLETLAQGTDLVVKDLLTAD
GSQALEQSRRLGWEGVVAKKWDSPYHPGRRSTAWVKEKHWRTQEVVIGGWRAGEGARGGG
IGSLLMGIPAGGKLTYVGRVGTGFTEGQLAALKKKLAPLRADESPFDAPLGRADAAGVTF
VRPSLVGEVRYSERTGDGRLRQPSWRGLRPDKTPDDVVSED
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgagccgttcaagacgcgggtgaaactgaccaacgccgacaaagtgctctac
cccgccaccggcaccaccaaagccgacgtcttcgactactacacccgcatcgccgaggtg
atgctgccgcacatcgccgggcgcccggccacccgcaaacgctggcccaacggtgtcgag
caggactccttcttcgaaaagcaactcgcgtcctcggcaccgtcctggctgcgccgcgcc
gcggtgcagcaccgctccgggaccaccacctatccgatcatcgacgaccccgacggcctg
gcctggatcgcccagcaggccgccttggaagtgcacgtcccgcagtggcgcttcgaggcg
gaatggactcgcggcggcgaggtgatcaaacccggccggtccacccggctggtgttcgac
ctggaccccggtgagggcgtgacgatgagccaactcgccgaagtggcacgcgcgatccgc
gatctgatggccgaactggacctggaggtgtttccgctcaccagcggcagcaagggcgtg
cacctctacgccccgctggatcgcccggtggccagcgacggcgccgtcgcggtggccaaa
cgcgttgcgcaacaactcgaaagcgccatgccgaagctggtgaccgccaccatggccaag
aagctgcgggccggcaaggtgttcttggactggagccagaacaacgcggccaagaccacc
atcgcgccgtattcactgcggggccgcgagcatccgacggtggccgcgccgcgcacctgg
gccgaactggacgatccgaagctgcggcagttgcgctacgacgaggtgctggctcgtgtc
gcccgcgacggcgacctgttggccgggctggacccgccgctgagcaaaccggaccgactc
agccactaccgggccaaacgcgacgcggccaagacccccgaaccggtgccggccgcagcc
ccggcgccggggggcggcaatagctacttcgttatccaggagcaccacgcccgccggctg
cactacgacttccggctggagcgcgacggcgtgctggtgagctgggcggtgcccaagaat
ctgcccgacgccccgtcggtcaaccatctcgcggtgcgcaccgaagaccacccgctggaa
tacgggagtttcgagggcaccatccccaagggcgaatacggcgcaggaacggtgcgcatc
tgggattcgggcagctatgtgaccgagaagttcgaggactccgccgaaaagggcgaggtg
atcgtcgtgttgcggggcagtcggatctcgggccgctacgcgctgatccggaccggcggc
gaccagtggctggcccaccggatgaaagatcagaagacgttcgccctcgccgacctggca
ccgatgctggccacccacggctcggtgactcgcctcgacccggacacctgggccttcgag
ggcaaatgggacggctaccggctgctggtcgatgccgaccggggccgggtgcggttgcgt
tcccgcagcggccgcgacgtcaccggcgagtacccgcagctgcggtcgctggccgccgac
ctcgccgaacaccacctcgtgctggacggagaagtcgtcgcgctcgacagcgccagcgtt
cccagcttcgccgcgatgcagaacagcgcccgctcgactcgggtggagttctgggccttc
gacctgctctacctagatggccgtccgctgctgcgcgcggcctaccgggaccgtcgccgc
ctgctggaaacactcgcgcaggggactgatttggtggtcaaggacctgttgaccgccgac
ggctcccaggcgctcgaacagtcccgccggctgggttgggagggcgtggtggccaagaaa
tgggactcgccctatcacccggggcgccggtcgacggcctgggtcaaggagaagcactgg
cggacccaggaggtggtgatcggcggctggcgggccggtgagggcgcccggggcgggggg
atcgggtcgctgctgatgggcattccggcgggaggcaagctcacctacgtcggtcgggtg
ggcaccggcttcaccgagggccaactggcggcgctgaagaagaagctggcgccgctgcgc
gccgacgaatcacccttcgacgcgccgctcggccgggccgacgccgccggggtcacgttc
gtgcgaccgagcctggtgggggaggtgcgctacagcgagcgcaccggcgacggtcggctg
cgccaaccgagctggcgcggactgcggcccgataagacgcccgacgacgtggtgagtgag
gattga

DBGET integrated database retrieval system