KEGG   Mycolicibacter terrae: 4434518_02630Help
Entry
4434518_02630     CDS       T05465                                 

Gene name
ddl
Definition
(GenBank) d-alanine--D-alanine ligase DdlA
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mter  Mycolicibacter terrae
Pathway
mter00473  D-Alanine metabolism
mter00550  Peptidoglycan biosynthesis
mter01100  Metabolic pathways
mter01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mter00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    4434518_02630 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    4434518_02630 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    4434518_02630 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mter01011]
    4434518_02630 (ddl)
Enzymes [BR:mter01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     4434518_02630 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:mter01011]
 Precursor biosynthesis
  Amino acid ligase
   4434518_02630 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp RimK ATP-grasp_3 ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: SNV81643
UniProt: A0A240AFK5
LinkDB All DBs
Position
1:complement(2807385..2808518)
Genome map
AA seq 377 aa AA seqDB search
MRPGCRTLWRVNSHQRTRVAVVFGGRSSEHAISCVSAGSILRNLDPQRFEVVAVGITPEG
SWVLTDGDPDALVISDRRLPAVSTADGAELTLPADPQRAGQLLAVGAGELLQSVDVVFPV
LHGPYGEDGTVQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLAAEGLPIGPYAVLRGAH
ATLSVEDRERLGLPVFVKPARGGSSIGVSRVTSYDELPAAIAEARRHDPKVIVEAAIVGR
ELECGVLEFPDGTVAASTVGEIRVAGVRDRDDSFYDFATKYLDDAAELDVPAKIDDDVAD
TVRQLAIRAFAALACQGLARVDFFHTDRGPVINEINTMPGFTTISMYPRMWAASGVDYPT
LLATMVDTALARGVGLR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgagaccgggttgccgtaccctctggcgtgtgaattcccaccagcgcacccgggtggcc
gtcgtgttcggcggccgcagtagcgagcacgcgatctcctgcgtgtcggcgggaagcatc
ctgcgcaatctcgatccgcagcgtttcgaggtggttgctgtggggatcactccggagggc
tcgtgggtgctcaccgacggtgacccggatgcgctcgtgatcagtgaccgtcggctgccc
gcggtgagcacggctgacggtgccgaactgacgctgcccgccgatccgcagcgggccggc
cagttgctggcggtgggtgccggggagctgctgcagtcggtcgacgtggtgttcccggtg
ctgcacggtccctacggcgaggacggcaccgtgcaggggctcctcgagttggccggcgtg
ccctacgtcggtgccggggtgctggccagtgccgccgggatggacaaggagttcaccaag
aagctgctggcggccgagggcctgccgatcgggccgtacgcggtcttgcggggagctcat
gcgacgctgtcggtcgaggatcgggagcggttggggctgccggtgttcgtcaaaccagcg
cgcggtgggtcgtcgatcggggtcagccgggtgacgtcgtacgacgagcttcccgccgcc
atcgccgaggcgcgccggcatgacccgaaggtcatcgtcgaggccgccatcgtcggccgc
gagctcgagtgcggagtgctcgaattccccgacggcacggtggccgccagcacggtgggg
gagatccgggtggccggcgtgcgggaccgcgacgactccttctacgacttcgccaccaag
tacctcgatgacgccgccgagctcgacgtgcccgccaagatcgacgacgacgtcgcggat
acggtgcggcagttagcaattcgcgcgttcgccgcactggcctgccagggcctggcccgg
gttgacttcttccacaccgaccgcggtccggtgatcaacgagatcaacacgatgcctgga
ttcaccacgatctcgatgtacccgcggatgtgggcggccagcggtgtggactatccgacg
ctgctggcgaccatggtcgacaccgcactggcccgcggcgtcggcctgcgctga

DBGET integrated database retrieval system