KEGG   Mycolicibacter terrae: 4434518_02725Help
Entry
4434518_02725     CDS       T05465                                 

Gene name
echA17
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mter  Mycolicibacter terrae
Pathway
mter00071  Fatty acid degradation
mter00280  Valine, leucine and isoleucine degradation
mter00281  Geraniol degradation
mter00310  Lysine degradation
mter00360  Phenylalanine metabolism
mter00362  Benzoate degradation
mter00380  Tryptophan metabolism
mter00410  beta-Alanine metabolism
mter00627  Aminobenzoate degradation
mter00640  Propanoate metabolism
mter00650  Butanoate metabolism
mter00903  Limonene and pinene degradation
mter00930  Caprolactam degradation
mter01100  Metabolic pathways
mter01110  Biosynthesis of secondary metabolites
mter01120  Microbial metabolism in diverse environments
mter01130  Biosynthesis of antibiotics
mter01212  Fatty acid metabolism
Module
mter_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4434518_02725 (echA17)
   00650 Butanoate metabolism
    4434518_02725 (echA17)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4434518_02725 (echA17)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4434518_02725 (echA17)
   00310 Lysine degradation
    4434518_02725 (echA17)
   00360 Phenylalanine metabolism
    4434518_02725 (echA17)
   00380 Tryptophan metabolism
    4434518_02725 (echA17)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4434518_02725 (echA17)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    4434518_02725 (echA17)
   00281 Geraniol degradation
    4434518_02725 (echA17)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    4434518_02725 (echA17)
   00627 Aminobenzoate degradation
    4434518_02725 (echA17)
   00930 Caprolactam degradation
    4434518_02725 (echA17)
Enzymes [BR:mter01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4434518_02725 (echA17)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: SNV82780
UniProt: A0A240AHK0
LinkDB All DBs
Position
1:complement(2900521..2901255)
Genome map
AA seq 244 aa AA seqDB search
MSEFVSVHSSSAGVATLALSRLPSNALTRQVYREITEAAEEVSARDDVAAVVLYGGHEIF
CAGDDVPELRTLISAEAERFAGIRHDAVEAVAAIGKPTVAAVTGYALGSGLALALAADWR
ISGDNVKFGATEILAGLVPDGAGLARLTRTIGASRAKELAYSGRFFDAEEALALGLIDDM
VAPDGVYEAALSWARRFVDAPRQALAAAKASIDTVATLPPAERAAADRRRYAQVFAAGHG
ENRQ
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaattcgtcagtgtgcactcgtcatcggccggggtggccaccctggcgctgtcg
cgtctgccgagcaacgccttgacccgccaggtctaccgggagatcaccgaggcggcggag
gaggtgtcggcgcgagacgacgtcgccgcggtggtgttgtacggcggccacgagatcttc
tgcgcaggtgacgacgttcccgaacttcgcaccctgatatccgccgaggccgaaaggttc
gccggcatccgccatgacgccgtggaggcggtggcggccatcggaaagccgacggtggcc
gcggtcaccggttacgcgctgggcagcggcctggcgctggcgttggcggcggactggcgg
atcagtggtgacaacgtcaaattcggcgccaccgagattctggccggcctggttcccgat
ggtgcggggctggcccggctgacccgcaccatcggcgcgagccgcgccaaggagttggcc
tacagcgggcggttcttcgacgccgaggaagcgctcgcgctgggcctgatcgacgacatg
gtggctcccgacggggtctacgaggcggccctgagctgggctcggcgcttcgtcgacgcc
ccgcggcaggcgctggccgcggccaaagcctcgatcgataccgtcgccacgctgcctccc
gccgagcgggccgcagccgaccggcgccggtatgcgcaggtgttcgccgcgggacacggc
gagaaccgtcaataa

DBGET integrated database retrieval system