KEGG   Mycolicibacter terrae: 4434518_03776Help
Entry
4434518_03776     CDS       T05465                                 

Gene name
gutB_3
Definition
(GenBank) dehydrogenase
Organism
mter  Mycolicibacter terrae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ThiF
Motif
Other DBs
NCBI-ProteinID: SNV93335
UniProt: A0A1X2DQW4
LinkDB All DBs
Position
1:3987922..3988938
Genome map
AA seq 338 aa AA seqDB search
MRAAVLRDRRMVYRNDVPEPTPGPGQVLVEVTACGICGSDLHFAAHGEQVLAATQSMSGS
PSSSASVDLAADIFMGHEFSARVLEAGPGTDTFPAGTPVTSIPVLLAAKGIEPIVYSNTT
VGGYAEKMLLSAPLLVPIPNGMDPRHAALTEPMAVGLHAVNKSGITPGETALVLGCGPIG
MAIIAALRTSGVEDIVAVDYSQIRRELATAMGAHRSLDPAQGSPFDTIEPKVVFEAVGVP
GIIDDVLRRTPVGSRLVVAGVCMQPDTVHPFFGIAKEISVQFVLAYEPAEFAASLRAIAE
GDIDVAPLITGEVGLDGVGTAFDDLTDPDRHCKILVTP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcggcggtgctgcgcgaccggcgcatggtctaccgcaacgacgtaccggagccc
acgcccggcccgggccaggtgctggtcgaggtgacggcctgcggcatctgcggttcggac
ctgcacttcgccgcgcacggcgagcaggtactggcggcgacgcagtccatgtcgggcagc
ccctcgtccagcgcgtccgtcgacctcgccgccgacatcttcatgggccacgagttcagt
gcacgggtgctggaggcgggacccggaaccgacacgtttccggccggcacaccggtcacc
tcgattccggtgttgttggccgccaaaggtatcgagccgatcgtgtactccaacaccacg
gtgggcggctacgccgagaagatgctgctgtcggccccgctgctggttcccatccccaac
ggaatggaccctcgccacgccgcgctgaccgagccgatggccgtgggactgcacgcggtc
aacaagtccggcatcacccccggcgaaacggcattggtgctgggctgcggcccgatcggg
atggcgatcatcgccgcactacgcacttctggcgtggaagacattgtggccgtggactat
tcccagatacggcgtgaactcgcgacggcgatgggtgcacaccggtcactcgacccggcg
caggggtcgccgttcgacacgatcgaaccgaaggtggtcttcgaagcggtcggcgtgccc
ggcatcatcgacgacgtgctgcggcgaacgccggtcggcagccgactggtcgtcgcaggg
gtgtgcatgcagcccgacacggtgcacccgttcttcggcatcgccaaggagatcagcgtg
cagttcgtgttggcctacgagccggcggagttcgccgcatcgctgcgggccatcgccgag
ggagacatcgacgtcgcgccgctgattaccggtgaggtcgggctcgacggcgtgggtacg
gcattcgacgacctgaccgaccccgaccggcactgcaagatcctggtcacgccctag

DBGET integrated database retrieval system