KEGG   Mycolicibacter terrae: 4434518_04098Help
Entry
4434518_04098     CDS       T05465                                 

Gene name
sodA
Definition
(GenBank) [Mn]-superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mter  Mycolicibacter terrae
Brite
Enzymes [BR:mter01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     4434518_04098 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: SNV95243
UniProt: A0A1X2E5I8
LinkDB All DBs
Position
1:4363573..4364193
Genome map
AA seq 206 aa AA seqDB search
MADYTLPDLDWDYGALEPHISGQINELHHSKHHAAYVSGANGALAKLEEARANDDHGAIF
LNEKNLAFHLGGHVNHSIWWKNLSPNGGDKPTGELAAAIDDAFGSFDKFRAQFTAAANGL
QGSGWAVLGYDTLGGKLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWADVQSRFAAATSKTSGLIF
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtggccgactacaccttgccggacttggactgggattacggagcccttgagccgcacatc
tcgggccagatcaacgaactgcaccacagcaagcaccacgccgcctacgtctccggcgcc
aatggcgccctggccaagcttgaagaggcccgcgccaacgacgaccacggcgcgatcttc
ttgaacgagaagaacctggccttccacctcggtgggcacgtcaaccactcgatctggtgg
aagaacctgtccccgaacggcggtgacaagccgaccggcgaactggccgccgccatcgac
gacgcgttcgggtcgttcgacaagttccgtgcgcagttcaccgcagccgccaacggcctg
cagggttcgggctgggcggtgctgggttacgacaccctcggcggcaagctgctgaccttc
cagctctatgaccagcaggccaacgtgccgctgggcatcatcccgctgctgcaggtcgac
atgtgggagcatgccttctacttgcagtacaagaacgtcaaggcggactacgtcaaggca
ttctggaacgtggtcaactgggccgacgtgcagtcgcggttcgcggccgccacctcgaag
acctcgggtctgatcttctag

DBGET integrated database retrieval system