KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_01580Help
Entry
MRGA327_01580     CDS       T01775                                 

Definition
(GenBank) fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
mtg00020  Citrate cycle (TCA cycle)
mtg00190  Oxidative phosphorylation
mtg00650  Butanoate metabolism
mtg01100  Metabolic pathways
mtg01110  Biosynthesis of secondary metabolites
mtg01120  Microbial metabolism in diverse environments
mtg01130  Biosynthesis of antibiotics
mtg01200  Carbon metabolism
Module
mtg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MRGA327_01580
   00650 Butanoate metabolism
    MRGA327_01580
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MRGA327_01580
Enzymes [BR:mtg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MRGA327_01580
    1.3.5.4  fumarate reductase (quinol)
     MRGA327_01580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 Fer4_7 Fer4_9 Fer4_16 Thioredoxin_7 Fer2_4 Fer4_10
Motif
Other DBs
NCBI-ProteinID: AFE15238
LinkDB All DBs
Position
complement(298297..299043)
Genome map
AA seq 248 aa AA seqDB search
MTYSASMRVWRGDESCGELREFTVEVNEGEVVLDVILRLQQTQTPDLAVRWNCKAGKCGS
CSAEINGKPRLMCMTRMSTFDEDEIVTVTPMRTFPVIRDLVTDVSFNYQKAREIPSFAPP
KELQPSEYRMAQVDVARSQEFRKCIECFLCQNVCHVVRDHEENKDAFAGPRFLMRIAELE
MHPLDTRDRRSQAQEEHGLGYCNITKCCTEVCPENIKITDNALIPMKERVADRKYDPVVW
LGSKLFRR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacagcgcgagtatgcgggtgtggcgcggagacgaaagctgtggcgaactccgc
gaattcaccgtggaggtcaacgagggcgaggtcgtgctggacgtcatcctccgtctacaa
cagacgcagacaccggatctcgcagtgcgctggaattgcaaagctggcaagtgcggatcc
tgctcggccgagatcaacggcaaaccgcgactgatgtgcatgacgcggatgtcgacattc
gacgaggacgagatcgtcacggtcaccccaatgcggacgtttccggtgattcgcgatctt
gttaccgacgtctcgttcaactaccaaaaagcgcgcgagatcccgtctttcgcgccaccc
aaggagctacagcccagcgagtaccgaatggcgcaagtcgacgttgcacgctcgcaggag
ttccgcaagtgcattgaatgcttcctgtgccaaaacgtctgccacgtagttcgcgatcac
gaggaaaacaaggatgcgttcgccggcccccgcttcctgatgcgaatcgccgaactcgaa
atgcatccgctggacacccgggaccgacgcagccaagcacaggaagagcacggcctgggc
tactgcaatatcaccaagtgctgcaccgaagtgtgcccagaaaacatcaagatcaccgac
aatgccctgatcccgatgaaagaacgggtcgccgaccgcaagtatgatccggtggtatgg
ctgggcagcaagctgtttcgccgctaa

DBGET integrated database retrieval system