KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_01585Help
Entry
MRGA327_01585     CDS       T01775                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
mtg00020  Citrate cycle (TCA cycle)
mtg00190  Oxidative phosphorylation
mtg00650  Butanoate metabolism
mtg01100  Metabolic pathways
mtg01110  Biosynthesis of secondary metabolites
mtg01120  Microbial metabolism in diverse environments
mtg01130  Biosynthesis of antibiotics
mtg01200  Carbon metabolism
Module
mtg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MRGA327_01585 (sdhA)
   00650 Butanoate metabolism
    MRGA327_01585 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MRGA327_01585 (sdhA)
Enzymes [BR:mtg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MRGA327_01585 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     MRGA327_01585 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 GIDA Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AFE15239
LinkDB All DBs
Position
complement(299044..300984)
Genome map
AA seq 646 aa AA seqDB search
MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKAHTVMAEGGCAAAMGN
ANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGALFDRTDDGRISQRN
FGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYEARIKVFAECTITELLKD
QGAIAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNSWEYTGDGHALALRAGATL
INMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENSRFMFDYIPPVFKGQYAETE
EEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTPHGGVYLDIASRLTPAEIKRR
LPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDADTGAATVPGLFAAGECAGGMHG
SNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSAEAIDAAAQQALSPFEGPKDGSA
PENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAELWSRYHNVLVEGHRQYNPGWNLS
IDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMDPNWRRILLVCRATETMGTGGSGSG
DSNCHINVTQQLQTPMRPDLLELFEISELEKYYTDEELAEHPGRRG
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggtcgagcggcactcctacgacgtagtcgtgatcggtgccggcggcgcgggg
ttacgcgcggtcatcgaggcgcgggaacgcggcttgaaagtagccgtcgtgtgcaaatcc
ctattcggcaaggcccacacggtcatggccgaaggcggctgcgcggccgcgatgggcaac
gccaacccgaaggacaattggaagactcacttcggcgacacgatgcgcggtggaaagttc
ctgaacaactggcgtatggccgagctgcacgccaaggaggcgccggaccgggtctgggag
ttggagacctacggcgcgctgttcgaccgcaccgacgatggccgaatcagtcagcgcaac
ttcggcggacacacctatccgcgactggcgcacgtcggcgaccgcaccggcctggagttg
atccgcaccctgcagcaaaaggttgtctcgctgcagcaggaggaccacgccgagctcggc
gactacgaagcgcggatcaaagtgttcgccgaatgcaccatcaccgaactgctcaaggac
caaggcgcgatcgccggagccttcggctactggcgggaaagcggccggttcatcgtgttc
gaggcgccagcggtggtgcttgccactggcgggatcggcaagtcgttcaaggtgacatcc
aactcctgggagtacaccggagacgggcacgcgttggcactgcgggccggggcgacgctg
atcaacatggagttcgtccagttccacccgacgggcatggtgtggccgcccagtgtcaag
ggaattctggtcactgagggtgttcgcggcgacggcggagtgctcaaaaactcggagaac
tctcgcttcatgttcgactacattccgccggtgttcaagggccagtacgccgagacggag
gaagaggccgaccagtggcttaaggacaacgactcggcccgacgcaccccggacttgctg
ccccgcgacgaggtcgcgcgcgcgatcaactcagaggtcaaggccggccgcggtaccccg
cacggcggcgtctacctcgacatcgcatcccggctgacacccgccgagatcaaacggcga
ttgccgtcgatgtatcaccagttcaaagagctcgctgaagtcgatatcacaacgcaggca
atggaagtcgggccgacgtgtcactacgtgatgggcggtgtcgaagtagacgcggacacc
ggcgccgccacggtgccaggcctgttcgctgccggtgagtgtgccggcggtatgcacggc
tccaaccggctgggcggcaattcgctgtccgatctgctggtattcggccggcgggccggc
ctgggcgcagcggattacgtacgggcactgagcagccggccagcggtttcagcggaggct
atcgatgcggcggcccagcaggcgctgagccccttcgaaggaccgaaagacggctcggcg
ccggagaatccgtacgcgctgcatatggacttgcagtacgtgatgaacgatctggtcggt
atcatccgcaacgccgacgaaatatccagggcgctgactcttttggccgagctgtggtcg
cgctaccacaacgtactcgtcgaaggtcaccgtcaatacaatccgggctggaacctgtcc
atcgacctgcgcaacatgttgctggtcagcgagtgcgtggccagagctgcgctacagcgc
accgaaagccgaggcggccacacccgagacgaccatcccggtatggaccccaactggcgc
aggatcttgctggtatgccgggccaccgaaaccatgggcaccggtggcagcgggtccggc
gactccaactgccacatcaacgtcacccagcagctgcaaacgcccatgcgacccgacttg
ctggagctcttcgagatctcggagttggagaaatactacaccgacgaagagctggccgag
catccaggacggagaggctaa

DBGET integrated database retrieval system