KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_23685Help
Entry
MRGA327_23685     CDS       T01775                                 

Definition
(GenBank) superoxide dismutase [Fe] SODA
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Brite
Enzymes [BR:mtg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MRGA327_23685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFE18624
LinkDB All DBs
Structure
PDB: 

Position
4289223..4289846
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAIL
LNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTV
QGSGWAALGWDTLGNKLLIFQVYDHQTNFPLGIVPLLLLDMWEHAFYLQYKNVKVDFAKA
FWNVVNWADVQSRYAAATSQTKGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaatacaccttgccagacctggactgggactacggagcactggaaccgcacatc
tcgggtcagatcaacgagcttcaccacagcaagcaccacgccacctacgtaaagggcgcc
aatgacgccgtcgccaaactcgaagaggcgcgcgccaaggaagatcactcagcgatcttg
ctgaacgaaaagaatctagctttcaacctcgccggccacgtcaatcacaccatctggtgg
aagaacctgtcgcctaacggtggtgacaagcccaccggcgaactcgccgcagccatcgcc
gacgcgttcggttcgttcgacaagttccgtgcgcagttccacgcggccgctaccaccgtg
caggggtcgggctgggcggcactgggctgggacacactcggcaacaagctgctgatattc
caggtttacgaccaccagacgaacttcccgctaggcattgttccgctgctgctgctcgac
atgtgggaacacgccttctacctgcagtacaagaacgtcaaagtcgactttgccaaggcg
ttttggaacgtcgtgaactgggccgatgtgcagtcacggtatgcggccgcgacctcgcag
accaaggggttgatattcggctga

DBGET integrated database retrieval system