KEGG   Microbulbifer thermotolerans: A3224_04085Help
Entry
A3224_04085       CDS       T04393                                 

Definition
(GenBank) penicillin binding protein PBP4B
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A3224_04085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mthd01002]
    A3224_04085
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mthd01011]
    A3224_04085
Enzymes [BR:mthd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A3224_04085
Peptidases [BR:mthd01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   A3224_04085
Peptidoglycan biosynthesis and degradation proteins [BR:mthd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   A3224_04085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AMX01876
UniProt: A0A143HK60
LinkDB All DBs
Position
complement(975716..977077)
Genome map
AA seq 453 aa AA seqDB search
MHYLATRALGLLAAVTLLISTASCSTLPSSPKTPFLLLQEAHRPEDAGFSRQGLARVDAL
IERDIAAGFPGAVLLVIKDGKIVKNTSYGYRQKFSGQVPLKHFQPMTTDTLFDLASNTKM
YATNFALQKLVSEGKLDLQAQVQHYLPEFRDTDSDPIKGKDTLRVIDLLHHSAGFMADPK
FHDPQAGGALYSQDRNKTLALLSKTPLAYEPGSKNVYSDMDYMLLGLIVERITGQRLDDY
VENTLYKPLGLKNTLFTPLQKGFQASDFAATELMGNTRGGTIAFPNIRTYTLRGEVHDEK
AFYAMGGVSGHAGLFSTTGDLAVLLQVMLNGGGYGAQQLFDRDTIARFTKPSEKNPTFAL
GWRTNGDASMQWMFGAYASRHAYGHTGWTGTLTVIDPTYNLGIVLLTNKKHSPVILSGQN
AGRFIGDFFAVGRYGEVVSAVYQALLEPAATPH
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcactacctcgccacccgtgcacttggcctgctggcggcagtgacactgctcatatcc
accgccagttgcagcaccctaccctcatcaccaaaaacccccttcctgttacttcaggaa
gcacacaggccggaggacgccggtttttcacggcaagggctggcgcgggtcgatgcactg
atcgaacgggatatcgcggcgggctttcccggcgcagtactgctcgtgattaaggatgga
aaaattgtcaaaaataccagttatggctaccggcaaaaattctccgggcaggtaccgctg
aaacacttccagcccatgacgacagacaccctgttcgatctggcttcaaatacaaaaatg
tacgcgaccaatttcgctctgcagaaactggtaagtgagggcaaactcgacctgcaggcc
caagtacagcactacctgccggagttccgcgacaccgacagcgaccctatcaagggcaag
gacacgctgcgggttatcgaccttttgcaccacagcgccggttttatggccgaccccaaa
tttcacgatcctcaagccggcggagcgctttactcccaagacagaaacaaaaccctggct
cttttgagcaaaacgccactcgcctatgaacccggcagcaaaaatgtttacagcgatatg
gactatatgctgctgggtctaatcgtagagcgaatcaccgggcagagactcgacgattat
gtagaaaacacgctgtacaaacccctggggctaaaaaacactctttttaccccgctgcag
aaagggttccaagcgagtgatttcgccgcaaccgaacttatgggcaacacccgtggcggc
acgatagcattccccaacatccgcacttataccctgcgcggcgaggtacacgacgaaaaa
gcgttttacgccatgggcggcgtctccgggcatgcgggcctcttctccaccaccggcgac
ctggccgttttgttacaagtgatgctcaatggcggtggctacggtgcacagcagctgttc
gaccgggacaccatcgcacggttcaccaagccatccgagaaaaaccccacctttgccctc
ggctggcggacaaacggcgatgcgagtatgcagtggatgttcggcgcttacgccagccga
cacgcctacggccacactggctggacggggacactgacggttatagaccccacctacaat
ctcggtatcgttctactgaccaacaagaagcactcgccagtgatcctgagcggccaaaac
gccggccgctttatcggcgacttttttgccgtcggccgctatggcgaagtggtgtccgcg
gtttaccaggcattgctggaaccggctgcgacaccccactga

DBGET integrated database retrieval system