KEGG   Microbulbifer thermotolerans: A3224_04280Help
Entry
A3224_04280       CDS       T04393                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd00550  Peptidoglycan biosynthesis
mthd01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A3224_04280
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A3224_04280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mthd01011]
    A3224_04280
Enzymes [BR:mthd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A3224_04280
Peptidoglycan biosynthesis and degradation proteins [BR:mthd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   A3224_04280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AMX01906
UniProt: A0A143HK90
LinkDB All DBs
Position
1018967..1020865
Genome map
AA seq 632 aa AA seqDB search
MAHDLHLKDPMTEQRLFRNRMLVAIAVVVLMLGVLVARFYHLQVVNYDSYRTQSDKNRIQ
VRPVAPTRGLIYDRNGELLADNRPSYTLAIVRERVRDLDATLELIGRLVRLDDSDVEKFR
QRMQRRRPFEPVPLRFRLSEDEIARISVNEFRLPGVSVEAELVRYYPRTDLFAHSVGYVG
RISDRELANFSEEDVRRYRGTQSIGKVGLERSYEDLLLGEVGYENVETNARGRVLRVLER
QDPKPGAALTLHLDSRLQKVASDALGDRRGAVVAIDVKTGGVLAFVSKPSFDPNLFVTGI
SFNDYRALSDSLDVPLFNRALQGQYPPGSTLKPMMGLGGLAAGIINAETRIKDPGFYRLP
NDPRIYRDWKRWGHGDKVDLVQALAESCDVYFWDMAYRWNIDGMHDIAARFGLGEKTGID
LPVERAGLFPSREWKRGARGLPWFPGDSLNAVLGQGFVLATPLQLAVMTATIASRGTHYR
PQMVKAVDGVVLPPEVLHHVEARPEHWDLVFKGMEAVVYSVRGTGKKAGAGLDFRVAGKS
GTAQVVGIAQGERYDSEALKERHRDHALFIAFAPVEDPQIAVSVLVENGEGGGKVAAPVA
REVFFDWLSRPGEKSAGLPPVTVDSEGGRLRG
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgacctccacctaaaagatccaatgaccgagcagcggctgtttcgcaaccgc
atgttggtggcgatcgctgtagtggtgctgatgttgggggtactggtggcgcgtttttat
catctgcaggtggtcaactacgacagctaccgcacccagtcggacaaaaaccgcatccag
gtgcgcccagttgcgccgacccgcggacttatctatgaccgcaacggtgagctgctggcg
gacaaccgtcccagctacacgctggcgatcgtgcgcgaacgggtgcgggatctggacgcc
accctggaactgatcggccgcttggtacgccttgatgacagtgacgtggaaaaattccgc
cagcgcatgcagcggcgtcggcccttcgagccagtgccactgcgcttccgtctcagcgag
gatgagatagcgcgtatcagtgtcaatgaattccgccttcccggagtgtcggtggaggcg
gaattggtgcgctattatccgcgcaccgaccttttcgcccacagcgttggctacgtgggc
cgtatcagcgaccgggagctggccaacttctcagaggaggatgtgcgccgctatcggggc
acgcaaagtatcggtaaggtgggcctcgaacgttcctacgaggatctgctgctgggcgaa
gtgggttacgaaaatgtggagaccaatgcccgcggtcgtgtattgcgggtgttggagcgc
caggatcccaagcccggcgccgccctgacgctgcacttggactcgcgcctgcaaaaggtg
gcctccgacgccctgggggacagacgtggcgccgtggtggccatagatgtcaaaaccggc
ggtgtgctggcctttgtcagcaagccctccttcgaccccaacctgtttgtaaccggcatt
agtttcaacgactaccgggcgctttccgattccctggacgtacccttgttcaaccgcgcc
ttacagggccagtatccgccgggttccaccttgaaacccatgatgggattggggggcttg
gcggcgggcataatcaatgccgagacccgcatcaaggacccgggcttttaccgtttgcct
aacgatccgcgcatctaccgggactggaaacgctggggccacggtgacaaggtggatctg
gttcaggcgctggcggaaagctgtgacgtctacttttgggatatggcctaccgctggaat
atcgatggcatgcatgacattgccgcccgtttcggcctgggtgagaagacggggatcgac
ttgccggtggagcgcgccggtctctttccatcgcgtgaatggaaacgcggcgcccgcggt
ctgccctggttccccggcgacagtctcaacgcggtactggggcaggggtttgtgttggct
actccactgcaactggcggtgatgaccgctaccatcgccagtcgcggcacccactatcgg
ccgcagatggtgaaggcggtggatggtgttgtactgccgccggaagtcttgcaccacgtg
gaggcgcgcccggagcattgggatctggtcttcaaaggtatggaggcggtggtatacagc
gtcagaggtaccggtaagaaagccggtgccgggctggatttccgcgtcgccggcaagtcg
ggcactgcccaggtggtcggtatcgcccagggtgagcgctacgattccgaggccctgaag
gagcgccaccgggaccacgccctctttattgcctttgcgcctgtggaggacccccagatc
gctgtgtcggtactggtggaaaacggcgagggtgggggcaaggtcgccgcgcctgtggcg
cgggaagtctttttcgactggttgtcgcggcccggagaaaaatccgcggggctgccgccg
gtaaccgttgacagcgaaggagggcgcctgcgtggctag

DBGET integrated database retrieval system